SKU: 13797946226

Ephrin B3 Fc Chimera Protein, Human

Sale price$225.00 Regular price$250.00
Save 10%

Pay in installments of $62.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Ephrin B3 Fc Chimera Protein, HumanProduct Specification Species Human Accession Q15768 Amino Acid Sequence Leu28 Ser224, with C terminal Human IgG Fc

Product Specification


Species Human
Accession Q15768
Amino Acid Sequence

Leu28-Ser224, with C-terminal Human IgG Fc

LSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPNYEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSLEPGKENLPGDPTSNATSRGAEGPLPPPSIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 60-65kDa (Reducing)
Purity

>95% by SDS-PAGE&RP-HPLC

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

 Ephrin-B3 binds HSPGs on HEK-293T, HeLa, and CHO cells, where heparin blocks binding to HEK-293T cells independently of Eph receptors, and a heparin/HS-binding domain in ephrin-B3 was identified outside of the Eph-receptors binding domain. The two positively charged residues, Arg178 and Lys179, in the ephrin-B3's juxtamembrane region is important for heparin/HS binding. Changing the corresponding amino acids in the non-heparin binding ephrin-B1 to positively charged residues gave heparin binding. Ephrin-A3 also binds HS, where Lys176 corresponds to Lys179 in ephrin-B3. Ephrin-B3 binding to lymphocytes and lymphoma cell lines may also depend on other residues near the transmembrane domain, in particular Arg188 which is less affected by heparin, suggesting several mechanisms for ephrin-B3 binding to cells. Functional studies revealed that ephrin-B3 binding to cells induces signaling, influencing both cell rounding and spreading.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 13797946226

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
joymom
Boise, US
★★★★★ 5
Great Value for a ball my dog loves!
Color: S6-muti-color
I wish these ball were in the subscription program! My dog gets sooo excited by the new ball, but her interest in things lasts for a few days. She kills the squeak within 11minutes, but the squeaker stays in place rather than becoming a chocking or swallow hazard, and she still loves to chew it. Next, we must throw the ball approximately 723 times the first day, possibly 496 times on day 2, and just 3- 4 on day 3, at which point she will chase the ball before hollering "it's over here if you need it," while she checks on the chipmunk den. We currently have 17 of these balls in our yard (because we have given several leftovers to a less discriminating doodle next door). These balls hold up really well, get her extremely active for the first couple of days, and are a much cheaper than doggie daycare (after an active morning with a new ball, she is happy to chew on it and sleep much of the day). I always have these on hand!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 22, 2025
M
Verified Purchase
Michelle
Omaha, US
★★★★★ 4
Pieces chewed off
Color: white & green
My Aussiedoodle loves it. I throw it down the hallway, it bounces crazy, and he chases it. The only complaint is that he can't chew much of the ball part. So now I have to have it put away and brought out for special playtime.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2026
Z
Verified Purchase
Zoe Mechler
Belleville, US
★★★★★ 5
Hyper Pet Tennis Balls for Dogs: Because Every Dog Deserves to Play Fetch Like a Pro
Color: Green, Size: Regular 2.5" - 12 Pack
If your dog had a bucket list, fetching tennis balls would probably be near the top. And if that’s the case, then the Hyper Pet Tennis Balls are their VIP ticket to Fetch World. These little balls of joy are the real deal, perfect for small breeds that are living their best life chasing after something that probably doesn’t need to be chased but is just so throwable. The 12-pack means you can never lose a ball again...unless, of course, it gets lost in a mysterious “dog dimension” where all the socks go. These 2.5-inch tennis balls are the right size for those dogs that aren’t quite large enough to play with the big leagues. Think of them as the perfectly sized appetizer for the full-on Fetch Feast. Plus, they’re made from non-toxic material, so your pup can gnaw on them all day without worrying about a tummy ache (unless they’re overzealous and gobble up the whole ball...don’t worry, I won’t judge). If your dog doesn’t love fetch yet, they will after these balls come into their life. They’re designed to be durable enough for constant chomping while still offering that classic “bounce, roll, and fetch” action that gets dogs going. Pros: • 12 balls = endless fetch sessions (until the dog gets tired, but let’s be honest, that’s probably never). • Perfect size for small breeds—no choking hazards, just good ol’ fun. • Non-toxic materials for guilt-free playtime. • They squeak. And we all know that squeak is like doggy kryptonite. • Durability means no more fetching balls that break after three tosses (we’ve all been there). Cons: • They might not hold up as well with very heavy chewers (but don’t worry, your dog won’t know the difference until they’ve already swallowed half of one). • They don’t come in tennis-ball-flavor. If they did, I think we’d all be out of a job. If you’re looking to upgrade your dog’s fetch game (or just keep them entertained while you catch up on your own Netflix binging), these Hyper Pet Tennis Balls are a solid choice. Plus, your dog will be too busy fetching to judge your questionable snack choices.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 13, 2024
L
Verified Purchase
lizzy
New York, US
★★★★★ 5
Prefect for smaller dogs to play
Color: Green, Size: MINI 1.75" - 12 Pack
The only balls my sato mix will fetch! They are a bit smaller than regular balls and are more comfortable in my dogs smaller mouth (she is about 20 lbs). Great bounce and durability, highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
M
Verified Purchase
MLW
Los Angeles, US
★★★★★ 5
Perfect Size - No Squeakers (yay)
Color: Pink, Size: MINI 1.75" - 4 Pack
My 9 lb. Chi-Mix adores her little toy balls. Perfect for her small size (or a medium dog) and full of bounce. I didn't want squeakers because I knew it would drive me nuts. No squeakers in these balls. Perfect training tool to teach fetch. Perfect toys to have play time with your pooch.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026

recommand products