SKU: 25611412820

Human Stratifin/14-3-3 sigma Protein, His Tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Stratifin/14-3-3 sigma Protein, His TagProduct Specification Species Human Synonyms 14 3 3 protein sigma, Epithelial cell marker protein 1, Stratifin, SFN, HME1 Accession P31947 Amino Acid Sequence Protein sequence (P31947, Met1 Ser248, with C His Tag)

Product Specification


Species Human
Synonyms 14-3-3 protein sigma, Epithelial cell marker protein 1, Stratifin, SFN, HME1
Accession P31947
Amino Acid Sequence

Protein sequence (P31947, Met1-Ser248, with C-His Tag) MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Expression System E.coli
Molecular Weight Predicted MW: 29.5 kDa Observed MW: 30 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

14-3-3 protein sigma (SFN), also known as Stratifin, is a crucial member of the 14-3-3 family. It functions as a phospho-serine/phospho-threonine binding protein that regulates a wide array of cellular processes, including cell cycle progression, apoptosis, and stress response. A key and well-characterized role of 14-3-3 sigma is its involvement in the DNA damage checkpoint, where it is transcriptionally activated by p53 and helps arrest the cell cycle. It often acts as a tumor suppressor, and its expression is frequently lost in various cancers through epigenetic silencing. Furthermore, 14-3-3 sigma is implicated in epithelial cell biology and is a significant marker in cancer research and diagnosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 25611412820

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Phoenix, US
★★★★★ 5
Great parts replacement kit for Eufy!
Size: Eufy B-18Packs, Size: Eufy B-18Packs
This kit has made it nice keeping up with our Eufy robot vacuum. All parts were free of defect and fit as it should. Instead of replacing individual piece by piece, I now just change all of the replacement parts at one time and it’s good to go for a while! Great value. Great quality. Will definitely be buying this kit again!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 7, 2026
T
Verified Purchase
Terry Jeglum
San Leandro, US
★★★★★ 5
Replacement quality is outstanding
Size: Eufy A-21Packs
Great value. Plug and play. Worked as designed
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
P
Verified Purchase
penny jerez
Los Angeles, US
★★★★★ 4
Perfect fit but originals last longer
Size: Eufy A-21Packs
With 4 cats and 2 dogs and using my Eufy RoboVac 11S Max twice a day until it dies, the brush and filters don't seem to last long. These replacement parts fit perfectly, but do not seem to have the same lifespan as the originals - would have to do the math to see if it would be worth buying original replacements, but that is probably case dependent. Overall happy, but took a star away for shorter wear life.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 1, 2025
H
Verified Purchase
Henry Holst
Omaha, US
★★★★★ 5
Excellent service
Size: 19pcs
Received parts in no time. Parts fit perfectly. Vacuum cleaner is back in operation at a very low price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
S
Verified Purchase
Sara Smithie
Massapequa, US
★★★★★ 5
Excellent Deal
Size: Eufy A-21Packs
Great deal - pricing is fantastic making it easy to keep my little robo-vaccum running smoothly. The replacement parts are super easy to click into place - and having these multi packs will last a long time. Packaging is secure and the delivery was quick. The brush quality is excellent and function well with the exsisting parts already in place. These are not 'remakes' or 'versions' but an exact match to the originals. The replacement parts keep the same level of low noise and look intact. No guessing required. I'd recommend these for anyone with an Eufy RoboVac.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 14, 2026

recommand products