SKU: 27701012022

Human papillomavirus type 16 E7 Protein

Sale price$108.00 Regular price$120.00
Save 10%

Pay in installments of $30.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human papillomavirus type 16 E7 ProteinProduct Specification Species Human papillomavirus type 16 Synonyms HPV 16 E7 Accession P03129 Amino Acid Sequence Protein sequence (P03129, Met1 Pro98) MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP Expression System E. coli Molecular Weight Predicted MW: 11. 0 kDa Observed MW: 17 kDa Purity 95% by SDS PAGE Conjugation Unconjugated Tag No Tag Physical Appearance Lyophilized Powder Storage Buffer 0.

Product Specification


Species Human papillomavirus type 16
Synonyms HPV 16 E7
Accession P03129
Amino Acid Sequence

Protein sequence (P03129, Met1-Pro98)
MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP

Expression System E.coli
Molecular Weight

Predicted MW: 11.0 kDa Observed MW: 17 kDa

Purity

>95% by SDS-PAGE

Conjugation Unconjugated
Tag No Tag
Physical Appearance Lyophilized Powder
Storage Buffer 0.2M PBS, pH7.4
Reconstitution

Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Human papilloma viruses (HPVs) can be classified as either high-risk or low-risk according to their association with cancer. HPV16 and HPV18 are the most common of the high-risk group while HPV6 and HPV11 are among the low-risk types. Approximately 90% of cervical cancers contain HPV DNA of the high-risk types. Mutational analysis have shown that the E6 and E7 genes of the high-risk HPVs are necessary and sufficient for HPV transforming function. The specific interactions of the E6 and E7 proteins with p53 and pRB, respectively, correlate with HPV high and low risk classifications. The high-risk HPV E7 proteins bind to pRB with a higher affinity than do the low-risk HPV proteins. Human papillomavirus (HPV) E7 plays a major role in HPV-induced malignancy, perturbing cell cycle regulation, and driving cell proliferation. Major targets of cancer-causing HPV E7 proteins are the pRB family of tumor suppressors, which E7 targets for proteasome-mediated degradation and whose interaction is promoted through an acidic patch, downstream of the LXCXE motif in E7, that is subject to phosphorylation by casein kinase II (CKII).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 27701012022

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 11 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
TenaMarie
Whiting, US
★★★★★ 5
A huge hit for the whole pack
Color: GREEN
​Finding a toy that appeals to multiple dogs with different play styles is tough, but this interactive green goose is an absolute home run. The combination of the crinkle wings and the squeaker keeps them entertained and busy way longer than a standard plush toy. ​Despite the daily thrashing, tugging, and chewing, the durability has been incredibly impressive. It’s the perfect size for larger breeds to grip, yet lightweight enough for smaller dogs to carry around by the neck.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
N
nubbles
Boise, US
★★★★★ 5
Great toy that's a real hit so far!
Color: YELLOW
This squeaky goose has been a total hit and, more importantly, it actually passed the "German Shepherd test." It is always a gamble with plush toys and large breeds, but this one has stayed completely intact after several play sessions. Even with all the shaking and carrying around, the seams are holding up perfectly and the squeaker is still going strong. The combination of the squeak and the crinkle wings keeps things interesting, and the material feels much more durable than your average stuffed toy. If you have a powerful chewer who still loves a soft toy to carry around, this is a great, resilient option that won't fall apart immediately.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2026
L
Verified Purchase
Lolly
West Palm Beach, US
★★★★★ 5
Great Bang for Your Buck
I didn’t know what to expect with these toys. How small are they, the quality, especially since they’re actually $1.33 each. I am so excited about these toys for my Havanese puppy! They’re a perfect size for him and they’re well sewn and cutely decorated. They’re stuffed and have a squeaker. He’s had one exactly like these for 2 months and he loves it and hasn’t torn it apart. When I saw the box delivered today I thought oh no these are so tiny. Until opened it and kept pulling perfect sized toys and a storage bag! These are just carefully and mindfully packed to fit in that box!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 20, 2025
N
Verified Purchase
nanny america
Phoenix, US
★★★★★ 5
Great deal
These are soooo cute... We have a 7lb dog and these are perfect... They are a nice size... Bigger than expected... Gave one to my 18lb dog and she had it in pieces in moments ..lol ... But these are great for a small dog. Well with the money
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 19, 2026
G
Verified Purchase
ginger
New York, US
★★★★★ 5
MY 6 LB PUP'S FAVORITES!
xcdOmg these are my 1 year old dog's favorite toys! He loves each one and they are just the right size for him to carry and squeak in his mouth. Currently the donut & pepper are his favorites. He even sleeps with them. Thank you for making good quality toys for our little guys and keeping them affordable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 6, 2026

recommand products