SKU: 32472010974

MDL-1/CLEC5A His Tag Protein, Mouse

Sale price$315.00 Regular price$350.00
Save 10%

Pay in installments of $87.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

MDL-1/CLEC5A His Tag Protein, MouseProduct Specification Species Mouse Accession Q9R007 Amino Acid Sequence Tyr26 Lys190, with N terminal 9*His HHHHHHHHHDDDDKYFPQVFGKSNDGFVPTESYGTTSVQNVSQIFGRNDESTMPTRSYGTVCPRNWDFHQGKCFFFSFSESPWKDSMDYCATQGSTLAIVNTPEKLKYLQDIAGIENYFIGLVRQPGEKKWRWINNSVFNGNVTNQDQNFDCVTIGLTKTYDAASCEVSYRWICEMNAK Expression System HEK293 Molecular Weight 27 35kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance

Product Specification


Species Mouse
Accession Q9R007
Amino Acid Sequence

Tyr26-Lys190, with N-terminal 9*His HHHHHHHHHDDDDKYFPQVFGKSNDGFVPTESYGTTSVQNVSQIFGRNDESTMPTRSYGTVCPRNWDFHQGKCFFFSFSESPWKDSMDYCATQGSTLAIVNTPEKLKYLQDIAGIENYFIGLVRQPGEKKWRWINNSVFNGNVTNQDQNFDCVTIGLTKTYDAASCEVSYRWICEMNAK

Expression System HEK293
Molecular Weight

27-35kDa (Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

CLEC5A is a spleen tyrosine kinase (Syk)-coupled C-type lectin that is highly expressed by monocytes, macrophages, neutrophils, and dendritic cells and interacts with virions directly, via terminal fucose and mannose moieties of viral glycans. CLEC5A also binds to N-acetyl glucosamine (GlcNAc) and N-acetylmuramic acid (MurNAc) disaccharides of bacterial cell walls. Compared to other C-type lectins (DC-SIGN and DC-SIGNR) and TLRs, CLEC5A binds its ligands with relatively low affinities. However, CLEC5A forms a multivalent hetero-complex with DC-SIGN and other C-type lectins upon engagement with ligands, and thereby mediates microbe-induced inflammatory responses via activation of Syk. For example, in vivo studies in mouse models have demonstrated that CLEC5A is responsible for flaviviruses-induced hemorrhagic shock and neuroinflammation, and a CLEC5A polymorphism in humans is associated with disease severity following infection with dengue virus. In addition, CLEC5A is co-activated with TLR2 by Listeria and Staphylococcus. Furthermore, CLEC5A-postive myeloid cells are responsible for Concanavilin A-induced aseptic inflammatory reactions. Thus, CLEC5A is apromis-Cuous pattern recognition receptor in myeloid cells and is a potential therapeutic target for attenuation of both septic and aseptic inflammatory reactions.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 32472010974

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
John Patrick Piontkowski
Lake Worth, US
★★★★★ 5
Great
Color: 1 Pro White
This new pro-level paddle is an absolute revelation, truly earning its five-star rating. My control instantly improved; dinks became effortless and drops landed precisely where I aimed them. The textured surface generates incredible spin, allowing for shots with wicked curve and dive. Power is readily available, transforming drives into piercing rockets across the court. Even during extended rallies, its balanced feel and quick handling keep me agile at the net. The sweet spot is incredibly generous, providing surprising forgiveness on less-than-perfect contact. It feels remarkably durable, shrugging off aggressive play without a scratch. This paddle doesn't just play well; it feels like a natural extension of my own hand, elevating my entire game. Seriously, if you're looking to upgrade your performance, this is the paddle you need.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 21, 2025
N
Verified Purchase
Nancy
Natrona Heights, US
★★★★★ 5
Why pay more ? This one works great.
Color: 1 Orange
Works great !
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 28, 2026
A
Verified Purchase
*ALURA*
Birmingham, US
★★★★★ 5
teS elddaP llabelkciP
Color: Sunrise
I got this pickleball paddle set for my husband and I to try and learn how to play this new popular sport. My first impressions of the rackets are they have a nice, solid feel to them but without feeling heavy. So solid yet lightweight would be an accurate description I think. After playing several rounds with my husband the grip still felt comfortable. Oh and I like the sling bag that comes with it. The bag is big enough to hold all the pickleball essentials. I noticed when we were practicing that the rackets seem to be responsive and easy to control. The rackets are constructed of fiberglass and polypropylene and I have not noticed any issues with them so far everything is intact just like new. It also comes with a few balls to get started. I would compare them to whiffle balls as they are very similar in shape and size. I am happy with my purchase of this outdoor pickleball set. It is a good value for the price, and a good starting point for beginners.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 3, 2025
J
Verified Purchase
Jackson Elderton
Los Angeles, US
★★★★★ 5
Love them
Color: Sunrise
Love the color of these and they’re great quality. Got as a gift for my niece who had expressed interest in starting to play pickleball so really loved the design of this set. Thought they are very reasonably priced for the high build quality and she's commented on how lightweight the rackets are yet very strong. Think this is a great stater set and would recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 28, 2024
D
Verified Purchase
Darshan
Birmingham, US
★★★★★ 4
Good quality at a great price!
Color: Blue
The box included everything mentioned. The Paddle feel light, and has enough power to smash. The grip is very comfortable too. The included "outdoor balls" feel lighter than what I'm used to, but worked well on a windy day. Great for beginners. It would make an excellent gift for a novice or intermediate player.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 24, 2025

recommand products