SKU: 43358953760

Human Calprotectin(S100A8), His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Calprotectin(S100A8), His tagProduct Specification Species Human Synonyms Calgranulin A; Calprotectin L1L subunit; Cystic fibrosis antigen (CFAG); Leukocyte L1 complex light chain; Migration inhibitory factor related protein 8 (MRP 8; p8); Urinary stone protein band A; CAGA Accession P05109 Amino Acid Sequence Protein sequence(P05109, Met1 Glu93, with C 10*His) MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKEGGGGSHHHHHHHHHH Expression

Product Specification


Species Human
Synonyms Calgranulin-A; Calprotectin L1L subunit; Cystic fibrosis antigen (CFAG); Leukocyte L1 complex light chain; Migration inhibitory factor-related protein 8 (MRP-8; p8); Urinary stone protein band A; CAGA
Accession P05109
Amino Acid Sequence

Protein sequence(P05109, Met1-Glu93, with C-10*His)
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKEGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 12.5 kDa Observed MW: 13.0 kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

S100A8 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis and post COVID-19 condition.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 43358953760

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
diane west
Birmingham, US
★★★★★ 5
An easy way to add protein to your diet
Flavor Name: Chocolate, Size: 11.5 Fl Oz (Pack of 12)
A nice way to add more protein to my diet. The taste in the texture are always the same. I like that it doesn’t change.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026
N
Verified Purchase
Nicole W
Lexington, US
★★★★★ 5
Perfect meal replacement protein shake
Flavor Name: Chocolate, Size: 11.5 Fl Oz (Pack of 12)
These shakes are super rich in chocolatey flavor. They are the perfect meal replacement or on the go protein. The quality is great and they are super refreshing. I recommend to drink them cold. They are way better.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
A
Verified Purchase
Anna
Phoenix, US
★★★★★ 4
Good protein option with good taste
Flavor Name: Chocolate, Size: 11.5 Fl Oz (Pack of 12)
These shakes are delicious. There are a few things about them I love. First, they are gluten-free. Next, they are low in sugar. They are also low in calories, and are very tasty. They do not leave an aftertaste like a lot of protein shakes. I do find you need to really shake them well to get a good consistency. They are not clumpy, but sometimes have strands that give them a weird texture. However, this does not happen if you shake them really well. I like to blend mine with fruit, and never have this problem when I do that. They are also really convenient because you can grab them and go. The serving size is perfect too. I would recommend these if you are looking for a low sugar, protein drink.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 26, 2026
A
Verified Purchase
Amazon Customer
Fort Morgan, US
★★★★★ 5
Love this Protein Drink!
Flavor Name: Chocolate, Size: 11.5 Fl Oz (Pack of 12)
MY husband and I are addicted to these shakes. The flavor is good and its packed with protein and other vitamins and minerals. Great afternoon snack.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
J
Verified Purchase
Jade
Fort Morgan, US
★★★★★ 5
Great product but prices are now the same or more than local stores
Flavor Name: Chocolate, Size: 11.5 Fl Oz (Pack of 12)
I really love this product, especially in these bottles. I drink it everyday. I bought it several times but they raised the price so I buy it locally now
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026

recommand products