SKU: 50602339356

Human Galectin-3, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Galectin-3, His tagProduct Specification Species Human Synonyms Gal 3, 35 kDa lectin, Carbohydrate binding protein 35 (CBP 35), Galactose specific lectin 3, Galactoside binding protein (GALBP), IgE binding protein, L 31, Laminin binding protein, Lectin L 29, Mac 2 antigen, LGALS3, MAC2 Accession P17931 Amino Acid Sequence Protein sequence(P17931, Met1 Ile250, with C 10*His)

Product Specification


Species Human
Synonyms Gal-3, 35 kDa lectin, Carbohydrate-binding protein 35 (CBP 35), Galactose-specific lectin 3, Galactoside-binding protein (GALBP), IgE-binding protein, L-31, Laminin-binding protein, Lectin L-29, Mac-2 antigen, LGALS3, MAC2
Accession P17931
Amino Acid Sequence

Protein sequence(P17931, Met1-Ile250, with C-10*His)
MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMIGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:27.8kDa Actual:35kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Galectin-3 is a member of the lectin family, of which 14 mammalian galectins have been identified. Galectin-3 is approximately 30 kDa and, like all galectins, contains a carbohydrate-recognition-binding domain (CRD) of about 130 amino acids that enable the specific binding of β-galactosides. Galectin-3 (Gal-3) is also a member of the beta-galactoside-binding protein family that plays an important role in cell-cell adhesion, cell-matrix interactions, macrophage activation, angiogenesis, metastasis, apoptosis. Galectin-3 is increasingly being used as a diagnostic marker for different cancers. It can be screened for and used as a prognostic factor to predict the progression of the cancer. Galectin-3 has varying effects in different types of cancer. One approach to cancers with high galectin-3 expression is to inhibit galectin-3 to enhance treatment response.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 50602339356

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
DeAnna
Los Angeles, US
★★★★★ 5
Clean and Fresh Water on the Go
Style: Standard Filter
I recently purchased the Camco TastePURE RV Water Filter with a flexible hose, and it has significantly improved the quality of the water in our RV. This new and advanced inline water filter offers a perfect combination of convenience, effectiveness, and durability, making it an essential addition for any RV owner. First and foremost, the performance of the Camco TastePURE Water Filter is impressive. It effectively removes impurities, odors, and bad tastes from the water, providing clean and fresh drinking water directly from the tap. The advanced filtration system reduces chlorine, sediment, and other contaminants, ensuring the water is safe and pleasant to drink. The inclusion of a flexible hose is a standout feature. The hose makes it easy to connect the filter to various water sources without straining or kinking. This flexibility is particularly useful when dealing with tight or awkward spaces often encountered at campgrounds or RV parks. The hose also helps to relieve pressure on the connections, reducing the risk of leaks. Installation is straightforward and user-friendly. The filter comes with clear instructions, and the connections are standard, making it easy to attach to most water sources and RV plumbing systems. The quick and hassle-free setup ensures you can start enjoying clean water almost immediately. The durability of the Camco TastePURE Water Filter is another strong point. Made from high-quality materials, the filter is built to withstand the rigors of outdoor use and frequent travel. The sturdy construction ensures it can handle varying water pressures without cracking or leaking, providing reliable performance throughout its lifespan. One of the major advantages of this water filter is its versatility. It is not only suitable for RVs but can also be used for boats, trailers, and even at home with garden hoses. This multipurpose functionality makes it a valuable investment for anyone looking to improve water quality in various settings. Maintenance of the filter is minimal and straightforward. The replaceable filter cartridges are easy to change, and the clear housing allows you to monitor the filter's condition and know when it's time for a replacement. This convenience ensures that maintaining clean and safe water is a simple and manageable task. In terms of value for money, the Camco TastePURE Water Filter is excellent. The combination of high-quality filtration, ease of use, and durability makes it a cost-effective solution for ensuring clean water in your RV. The peace of mind that comes with knowing you have access to safe drinking water is well worth the investment. In summary, the Camco TastePURE RV Water Filter with a flexible hose is a must-have accessory for any RV owner. Its advanced filtration system, durable construction, and easy installation make it a standout choice for improving water quality on the go. I highly recommend this water filter to anyone looking to enhance their RV experience with clean and fresh drinking water. It has exceeded my expectations and has become an essential part of our RV setup.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 13, 2024
D
Verified Purchase
Diana
Battle Creek, US
★★★★★ 5
Good for using for makeshift folding RV counter
Size: 10 Inch
We installed these shelf brackets in our RV to use as an extension of the counter, using the sink cover. Because we do not want to screw the sink cover to the brackets, we have used velcro to attach it to the brackets. This has worked very well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 16, 2026
C
Verified Purchase
CWD
New York, US
★★★★★ 5
Great brackets for miter saw table
Size: 8 Inch, Size: 8 Inch
Used these brackets to make a fold out shelf for my miter saw table
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2026
D
Verified Purchase
Dan M.
Dallas, US
★★★★★ 5
Great light duty hinges
Size: 10 Inch
These worked great for my miter saw table foldable extensions. Smooth with solid and locking mechanisms
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 1, 2026
K
Verified Purchase
Kriss Michaud
Waukegan, US
★★★★★ 4
Almost perfect
Size: 16 Inch, Size: 16 Inch
Only reason I gave it 4 stars is, they aren’t exactly 90 degrees. I used them on a work bench and I could shim them to be right. If these were a critical component they would be off.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 21, 2026

recommand products