SKU: 61705221753

CD47 His Tag Protein, Mouse

Sale price$243.00 Regular price$270.00
Save 10%

Pay in installments of $67.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD47 His Tag Protein, MouseProduct Specification Species Mouse Antigen CD47 Synonyms MER6, IAP, OA3 Accession Q61735 Amino Acid Sequence Gln19 Lys140, with C terminal 8*His QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEKGGGSHHHHHHHH Expression System HEK293 Molecular Weight 33 43kDa (Reducing) Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized

Product Specification


Species Mouse
Antigen CD47
Synonyms MER6, IAP, OA3
Accession Q61735
Amino Acid Sequence

Gln19-Lys140, with C-terminal 8*His 
QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEKGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 33-43kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Brown E J. et al. (2001) Integrin-associated protein (CD47) and its ligands. Trends Cell Biol. 11(3): 130-135.

Background

CD47, also known as Integrin-associated protein (IAP), is a typical representative of the "marker of self" of targets expressed by all types of cells. CD47 is a glycoprotein with an immunoglobulin variable N-terminal domain, five transmembrane domains, and a short C-terminal intracellular tail with four variably different splicing isomers, resulting in four isoforms. CD47 is an immune cell group that plays a major role in targeted tumor immunotherapy. CD47 expressed by cancer cells interacts with SIRP-α and SIRP-γ expressed by NK cells to protect cancer cells from phagocytosis and elimination. CD47 was highly expressed in a variety of solid tumor cells and malignant hematoma cells, and its expression level was positively correlated with disease progression.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 61705221753

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
James David Reyome
Waukegan, US
★★★★★ 5
Almost the perfect watch
Color: Black/Blue
I have owned three earlier models of these things going back to the days when I actually ran road races. They are brilliant pieces of work. My only complaint of them was that the start/stop/split button(s)--there were two on the older models--were too small. Well, apparently Timex listens and the two small buttons are now combined into one larger one. Probably this was done years ago but I'm only now getting back into road work, so now I get to discover it. The perfect watch? Almost. I especially like this model as my eyes are not what they used to be and the oversized face makes it easier to read. The downside to this is that it also makes the crystal easier to scratch. That's always been an issue, but I can live with it. No, the real problem with this product is, was, and apparently ever shall be, the band. Now, it could be worse, it could be a resin band (like the old ones) that will crack and break within a couple of years, but no, this is a nylon and velcro wrap style which should be just dandy, but for three glitches: 1. it's too short 2. it's too narrow (gee whiz, Timex designers, it's an oversized watch, why not a matching oversized band?) and 3. it's still resin where it attaches to the actual watch. Now, I imagine it's probably less prone to breakage in how it's implemented, but if you should choose to replace it, I can see no obvious way of removing it short of cutting it off. Really? But these are minor complaints. I doubt it would be comfortable on anyone whose wrists are much bigger than my own, but replacement bands are everywhere, and this watch will keep time with style and it's brilliant at splits. Heck, it even functions admirably as a backup for my expensive stopwatches at our regular short track stock car events. For my money (and did I mention the price is wonderful?) the Ironman is still the best at what it does, and for what it can do.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 19, 2014
S
Verified Purchase
striker
Charlottesville, US
★★★★★ 5
Good hard use watch.
Color: Black/Silver-Tone
Review Calibration: 3 stars means it works as advertised, nothing special during use, and no amazing features. Higher stars mean better-than-expected performance and features. This is 5 stars because it is my favorite work/hard-use watch. I have been wearing one for years, and like all Timex watches, it can take a beating. I have to replace it when the band's ears get so damaged that they won't hold the band on. This has more to do with the plastic's lifespan than with a design issue. I am hard on watches. This watch normally lasts ne 7-10 years between replacements.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2026
A
Verified Purchase
Amazon Customer
Houston, US
★★★★★ 5
Great watch
Color: Black/Silver-Tone
Great watch, with many features, specially for those that travel in various time zones.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026
M
Verified Purchase
Marc McC
Whiting, US
★★★★★ 4
Typical Ironman quality
Color: Black/Silver-Tone
This is my fourth Timex Ironman watch. I own many watches, and prefer the Ironman for casual wear and sporting activities as well as swimming and snorkeling. I decided to replace an earlier model with this one rather than pay to change the battery. The Ironman has changed very little over the years since its introduction in the '80s, with the exception of cosmetic improvememnts and a larger display. I selected the "oversize" model as I was looking for a little more heft to this model. This watch fits the bill, not as chunky as my G-Shock. A pleasant surprise was the weight of the watch. This model is lightweight, another advantage over the G. It's larger than the typical Ironman model, but about the same weight. The band lacks the stiffness of some other Timex and Casio models, and is quite comfortable. Typical Ironman functions are unchanged, and the ability to "hide" various functions makes operation of the watch more efficient. There are three time zones, useful when traveling, as well as the usual chronograph/timer and alarm functions. I haven't worn the watch in the pool or ocean yet, but if experience is any guide, I expect no problems. I've never had an Ironman leak, whether during water sports or snorkeling. These are great watches for the money. I prefer 200 meter water resistance for this type of watch, but Timex has yet to build an Ironman 200m that doesn't overwhelm my wrist in weight and size. I'm not a big guy, and they are simply too large for my wrist. Looking forward to years of service with this watch. Definitely a good timepiece for the price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2013
L
Verified Purchase
L C
Omaha, US
★★★★★ 5
Will not be disappointed
Color: Black/Blue
Keeping in mind that I received this item yesterday (2/24/16), I absolutely love this watch. The reason I have so much confidence with this watch is because I've owned one other Timex similar to this one, and it served me extremely well and is still able to do so. First off, this watch is certainly aesthetically pleasing. The blue color around the face of the watch and outline in the band, goes really well with the black frame. It's just an overall nice looking watch. More importantly, the quality seems great. As I mentioned, I've owned a Timex expedition, which I've had for more than 2 years, and it's still working perfectly fine. The watch seems like it's put together very well and there's no loose or flimsy parts. One complaint that many people seem to have with Timex is the quality of their band. Unfortunately I'd have to agree, since the band on my other Timex that's still working like the first day I got it, cracked and broke and is only being held together by the nylon fabric on the other side of the band. You're not going to have that problem with this watch. It's a full nylon band with Velcro adjustment, for precise fitting. it feels extremely comfortable and you won't need to worry about the band cracking (although I'm sure there will be certain defects in a mass produced bunch). I will use this watch for work and running, and rarely plan on taking it off. Just to give you an idea, I also have a garmin gps watch that I love and obviously has more functions than this watch. However, the second I received this watch, I slapped it on and put my garmin to the side. This watch also looks amazing when you wear it. I'll update this feedback as needed, but I'm confident this watch will serve me for years to come, just as my other one has.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 25, 2016

recommand products