SKU: 65654209826

CD7 Ligand/SECTM1 Fc Chimera Protein, Human

Sale price$226.80 Regular price$252.00
Save 10%

Pay in installments of $63.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD7 Ligand/SECTM1 Fc Chimera Protein, HumanProduct Specification Species Human Antigen CD7 Ligand Synonyms CD7 Ligand, SECTM1, K12 Accession Q8WVN6 Amino Acid Sequence Gln29 Gly145, with C terminal Human IgG1 Fc

Product Specification


Species Human
Antigen CD7 Ligand
Synonyms CD7 Ligand, SECTM1, K12
Accession Q8WVN6
Amino Acid Sequence

Gln29-Gly145, with C-terminal Human IgG1 Fc QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 44-49kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Lyman S D. et al. (2000) Identification of CD7 as a cognate of the human K12 (SECTM1) protein. J Biol Chem. 275(5): 3431-3437.

2、Lam G K. et al. (2005) Expression of the CD7 ligand K-12 in human thymic epithelial cells: regulation by IFN-gamma. J Clin Immunol. 25(1): 41-49.

Background

SECTM1 (secreted and transmembrane 1), also called K12, is either found as an approximately 27 kDa intracellular type I transmembrane protein that shows a perinuclear, Golgi like staining pattern, or as a 20 kDa soluble, secreted form. SECTM1 is expressed on thymic epithelial and fibroblast cells, breast cancer and leukemia cell lines, and neutrophils but not in peripheral lymphocytes. SECTM1 is expressed on cytomembrane, which is identified as a CD7 ligand.CD7 is expressed in T and natural killer (NK) cells, which could be activated by its ligand SECTM1, thus promoting the proliferation of T and NK cells. SECTM1 strongly costimulates CD4 and CD8 T cell proliferation and induces IFN-γ production, likely via a CD7-dependent mechanism. In addition, SECTM1 synergizes with suboptimal anti-CD28 to strongly augment T cell functions. A robust induction of IL-2 production when SECTM1 and anti-CD28 signals were present with TCR ligation.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 65654209826

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
KikaBrazil
Battle Creek, US
★★★★★ 5
Gentle protection for sensitive kids’ skin ☀️
Style: NEUTROGENA SHEER ZINC, Size: 3 Fl Oz (Pack of 1)
I’ve been trying to be more careful about what I use on my kids’ skin, and this sunscreen has been such a good find. It blends better than most mineral sunscreens I’ve tried, doesn’t have a strong smell, and feels gentle on sensitive skin. I also love that it gives solid sun protection without feeling too heavy or greasy. Perfect for beach days, playground time, or just everyday use outdoors. 😊
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026
N
Verified Purchase
new yorker
Louisville, US
★★★★★ 5
Worth the price, ?sheer
Style: NEUTROGENA SHEER ZINC, Size: 1.5 Fl Oz (Pack of 1), Style: NEUTROGENA SHEER ZINC, Size: 1.5 Fl Oz (Pack of 1)
2021 update: My family has been using this formulation for many years now. I chose it for the high (>20%) mineral content of zinc oxide, because that is the substance responsible for the sunscreen effect of this product. Unfortunately that is also the substance responsible for the white cast on the skin. Other brands typically have mineral content in amounts around 8-12% of the product. So although you may not get as white of a cast with those brands, you are also not getting as much of the sunscreen ingredient either. Another way manufacturers combat the white cast problem is to grind the minerals into ultra-fine particles: nanoparticles. There are downsides to this however: loss of UVA blockage, potential lung damage from inhalation of both manufacturing workers and users, possible coral reef and aquatic life disturbance. So, I expect and accept a mild white cast when using this because it is related to its effectiveness and probable lack of nanotization. When I care about the white cast, I use a drop or two of foundation with it. Otherwise, I leave it alone because after rubbing gently in, it’s not very noticeable. No problems with stickiness or tackiness a minute or so after applying and I’ve never had it sting my or my kids eyes probably because it stays put unlike many liquid formulas. I can also attest to its effectiveness as a sunscreen. We use it in the summertime by the beach and at the lake. In the winter and spring time we use it at 10,000 feet elevation while skiing. If we are going to be outdoors in the sun for any significant period of time, we use it then too. Does the job every time. We are diligent about reapplying after swimming or sweating. The pics I posted for comparison of stick sizes. Now go have fun in the sun...after putting on your sunscreen. ----------------------------------------------- Original post: My kid's skin is sensitive to chemical sunscreens so I get only ones made with mineral sunscreens. Sticks are much easier to apply on the face; less mess and hassle. The price of this large stick was off putting at first, but I got it because of the value in price per product; see pics. Very happily, I find it easier to apply than the smaller sticks. Takes less time to swipe on the face and anyone who has ever tried applying sun screen on the face of a child knows, less time to apply is a huge bonus!!! Same effectiveness in preventing sun burns as the smaller versions. I'm buying another one now.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 26, 2020
R
Verified Purchase
Rae
Louisville, US
★★★★★ 5
It works great
Style: NEUTROGENA SHEER ZINC, Size: 1.5 Fl Oz (Pack of 1)
Bought this numerous times for ease of use and how good it works. After countless summer days at the zoo, park or amusement park this is the best at staying on and protecting our kids skin. They do have sensitive skin and it does not irritate it either. Will continue to buy!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 1, 2026
B
Verified Purchase
BK2012
Pawtucket, US
★★★★★ 4
Keep it in a cool environment or else
Style: NEUTROGENA SHEER ZINC, Size: 1.5 Fl Oz (Pack of 1)
I think it’s great for kids and I’ve used it and rebought it for years but my only complaint which I’m surprised no one mentions is if it’s warm out, the sunscreen stick melts quite easily in your bag or car and then the stick softens and falls off the applicator making it pretty unusable. Also similarly, if a child pushes the stick out too far, it’ll fall off the applicator. So that wastes a lot for me every time!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026
A
Verified Purchase
Alexa
Bozeman, US
★★★★★ 5
No more sunscreen in our hair!
Style: NEUTROGENA SHEER ZINC, Size: 1.5 Fl Oz (Pack of 1)
The only kids sunscreen stick I've found that actually glides on. After struggling with too-hard sticks and messy lotions, this is so easy to apply to my wiggling toddler. And the large size makes application to the whole body a breeze. This is perfect to keep in the diaper bag and quickly reapply for the whole family.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026

recommand products