SKU: 69553936724

TRKB(NTRK2) Protein

Sale price$345.15 Regular price$383.50
Save 10%

Pay in installments of $95.88 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TRKB(NTRK2) ProteinProduct Specification Species Human Synonyms NTRK2TRKB Accession Q548C2 Amino Acid Sequence L456 G822(end)

Product Specification


Species Human
Synonyms NTRK2,TRKB
Accession Q548C2
Amino Acid Sequence

L456-G822(end)

LARHSKFGMKGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG

Expression System Baculovirus-InsectCells
Molecular Weight 68.1 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag GST Tag
Physical Appearance Liquid
Storage Buffer 50mM Tris, 150mM NaCl, 1mM DTT, 10% glycerol, pH7.5
Stability & Storage

Stable for 12 months upon stored at -80℃ from the date of receipt. And avoid repeated freeze-thaws cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 69553936724

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
AlbanyBarb
Fort Morgan, US
★★★★★ 4
Denim like fabric with some padding
Size: 14 inch, Color: Bright Rose
Adequate for the job. I wanted something bright colored and padded to hold my laptop safely in my carryon.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2026
M
Verified Purchase
M.O.O.
Houston, US
★★★★★ 5
Sleek, Durable Laptop Sleeve That Punches Above Its Price
Size: 13.3 inch, Color: Red
Right out of the box the sleeve felt premium—sleek exterior, soft interior lining, smooth zipper—and it’s held up flawlessly through daily use with no pilling or wear. My 13‑inch MacBook slides in snugly without adding bulk, and the padding gave me real confidence after I accidentally knocked the bag off a chair and the laptop came out unscathed. The front pocket fits my charger, hub, and other small accessories neatly, making it practical for coffee‑shop days, though I do wish it had a grab handle, but it is ok. For the price, this sleeve delivers excellent protection and finish that rivals much more expensive options.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2026
S
Verified Purchase
Steve Turner
Los Angeles, US
★★★★★ 5
Triple Check Your Measurements. No Margin For Error.
Size: 15 inch, Color: Space Gray
Exterior is exactly 15" wide making for a snug fit of my 14 1/8" laptop. This snug fit was what I was looking for. Any tighter and it wouldn't fit at all. The material is of good quality and the lining is soft. The padding is minimal but should be adequate for everyday use. First impressions are this is a very good quality sleeve. Time will tell.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026
M
Verified Purchase
MN Reviewer
Los Angeles, US
★★★★★ 5
13.3-inch bag is too big for a 13-inch Surface Pro 11
Size: 13.3 inch, Color: Gray
The bag is very good, but I am returning the 13.3-inch size bag, as it is too big for a Microsoft Surface Pro 11 (13-inch screen). I should have done a bit more digging through the description to realize the size. It would have been better if the pictures showed actual inner dimensions. I have just ordered a 12.3-inch bag. The smaller bag should be adequate. EDIT: The 12.3 inch bag came in. This bag is perfect for Surface Pro. Great fit! The front pocket holds the power brick and a small mouse, and a bit more space for flash drive or similar.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
C
Verified Purchase
Cristina Yamashiro
Belleville, US
★★★★★ 5
Nice color and good quality
Size: 14 inch, Color: Navy Blue, Size: 14 inch, Color: Navy Blue
I had originally bought this for my work laptop (MacBook) and it fit perfectly. But now I use it for my personal which is a 13.3in MacBook Air. I like the feeling of the case. I have a crack on my screen and I feel like this case offers more cushion than my previous one. I wouldn’t say this would save my laptop from a fall but I feel more confident as it’s in my bag that it’s getting enough protection. I also like the color and it’s spacious enough to hold a laptop charger, note pad, pens, etc.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026

recommand products