SKU: 69553936724

TRKB(NTRK2) Protein

Sale price$345.15 Regular price$383.50
Save 10%

Pay in installments of $95.88 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TRKB(NTRK2) ProteinProduct Specification Species Human Synonyms NTRK2TRKB Accession Q548C2 Amino Acid Sequence L456 G822(end)

Product Specification


Species Human
Synonyms NTRK2,TRKB
Accession Q548C2
Amino Acid Sequence

L456-G822(end)

LARHSKFGMKGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG

Expression System Baculovirus-InsectCells
Molecular Weight 68.1 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag GST Tag
Physical Appearance Liquid
Storage Buffer 50mM Tris, 150mM NaCl, 1mM DTT, 10% glycerol, pH7.5
Stability & Storage

Stable for 12 months upon stored at -80℃ from the date of receipt. And avoid repeated freeze-thaws cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 69553936724

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Lori Sharpe
Lexington, US
★★★★★ 5
Amazing smell, awesome price, and nothing synthetic
Scent: Honey & Sweet Orange, Size: 5 Ounce (Pack of 1)
This is a new staple in my skincare regimen! With no synthetic perfumes dyes, or preservatives, it smells wonderful, melts into my skin without leaving a greasy film. I use it morning and evening on my face and body, and my skin never feels dry. It leaves my skin soft and moisturized and I have this on subscription. The price is great, at about $20 for 5 Oz of nonwhipped, but soft, balm.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
D
Verified Purchase
D. Rae
Natrona Heights, US
★★★★★ 5
Perfect consistency and gentle enough for rosacea
Scent: Honey & Sweet Orange, Size: 5 Ounce (Pack of 1)
This is one of the best tallow-based moisturizers I’ve tried. I rarely leave reviews, but this product truly deserves one. The consistency is perfect—rich and nourishing without feeling heavy or greasy, and it absorbs beautifully into the skin. It doesn’t feel thick or like you’re wearing a mask. The scent is also very mild with a light hint of orange that fades quickly after application, which I really appreciate since many natural products can be overpowering. I have rosacea and very sensitive skin, and this is one of the few natural skincare products that hasn’t caused irritation or redness. It leaves my skin feeling calm, hydrated, and balanced. If you’re looking for a high-quality tallow moisturizer for sensitive or rosacea-prone skin, I highly recommend giving this one a try.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 7, 2026
R
Verified Purchase
RKL
West Palm Beach, US
★★★★★ 3
Too thick and greasy for my sensitive skin
Scent: Honey & Sweet Orange, Size: 5 Ounce (Pack of 1), Scent: Honey & Sweet Orange, Size: 5 Ounce (Pack of 1)
This is the fifth different beef tallow product that I’ve tried in the last few months. I’ve been in search for the perfect one that doesn’t leave my skin feeling greasy. I was really excited to try this after reading the great reviews, however this product is not for me. It is very thick, almost waxy like and I almost have to use my fingernail just to get it out. I know it’s not whipped and that it’s a balm, but it is way too thick and heavy for me. I’ve been looking for a nice moisturizer for my face, but this is far too greasy for my oily sensitive skin, especially on my face. I have been using it on my chest and neck and even on my legs and it is very hydrating and makes my chest extremely soft, even 12 hours after I put it on. I love that it’s a clean product with great ingredients. It has a very mild scent, almost non-detectable. I was really hoping this would be a good one for my face, sadly it did not hit the mark for my sensitive skin.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 3, 2026
R
Verified Purchase
Renee
Birmingham, US
★★★★★ 5
Amazing!
Scent: Unscented, Size: 8 Ounce (Pack of 1), Scent: Unscented, Size: 8 Ounce (Pack of 1)
I’ve been using this for a few days now and my skin has already improved so much!! My skin feels sooo much smoother, especially in the areas where my dry spots were really showing. This tallow helped smooth everything out and absorbed into my skin amazingly. I honestly have nothing but good things to say about this product. I also love that it comes in a big jar because I use moisturizer 24/7, so this will definitely last me a while. It’s been especially amazing for my eczema it cleared up within just a few days! I will forever repurchase this and recommend it to everyone. There’s no fragrance, which I love. It does feel a little greasy at first, but that goes away pretty quickly once it absorbs. The application, size, and absorption are all amazing 💕
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
L
Verified Purchase
Luz Lopez
Birmingham, US
★★★★★ 5
very amazing product
Scent: Unscented, Size: 8 Ounce (Pack of 1), Scent: Unscented, Size: 8 Ounce (Pack of 1)
i love this product. it’s very smooth and buttery. no scent and truly good for skin.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026

recommand products