SKU: 81495002018

MERTK His Tag Protein, Mouse

Sale price$271.80 Regular price$302.00
Save 10%

Pay in installments of $75.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

MERTK His Tag Protein, MouseProduct Specification Species Mouse Synonyms MER, STK Kinase, Tyro12, C Eyk, C Mer, RP38 Accession Q60805 Amino Acid Sequence Gly19 Met497, with C terminal 8*His

Product Specification


Species Mouse
Synonyms MER, STK Kinase, Tyro12, C-Eyk, C-Mer, RP38
Accession Q60805
Amino Acid Sequence

Gly19-Met497, with C-terminal 8*His GGTAEKWEETELDQLFSGPLPGRLPVNHRPFSAPHSSRDQLPPPQTGRSHPAHTAAPQVTSTASKLLPPVAFNHTIGHIVLSEHKNVKFNCSINIPNTYQETAGISWWKDGKELLGAHHSITQFYPDEEGVSIIALFSIASVQRSDNGSYFCKMKVNNREIVSDPIYVEVQGLPYFIKQPESVNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEKPERSPSVLTVPGLTETAVFSCEAHNDKGLTVSKGVHINIKVIPSPPTEVHILNSTAHSILVSWVPGFDGYSPLQNCSIQVKEADRLSNGSVMVFNTSASPHLYEIQQLQALANYSIAVSCRNEIGWSAVSPWILASTTEGAPSVAPLNITVFLNESNNILDIRWTKPPIKRQDGELVGYRISHVWESAGTYKELSEEVSQNGSWAQIPVQIHNATCTVRIAAITKGGIGPFSEPVNIIIPEHSKVDYAPSSTPAPGNTDSMGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 80-110kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Graham, D.K. et al. (1994) Cell Growth Differ. 5:647.

2.Graham, D.K. et al. (2006) Clin. Cancer Res. 12:2662.

Background

Tyrosine-protein Kinase Mer, also known as c-Mer and MerTK, is a member of the receptor tyrosine kinase subfamily TAM (Tyro3, Axl, and Mer). Similar to Axl and Tyro3, the extracelluar domain of Mer contains two Ig-like motifs and two fibronectin type III motifs. Mer is not expressed in normal B- and T-cells but expressed in neoplastic B- and T-cell lines . It is also show higher expression in immunosuppressive M2‑like macrophages. Following activation by ligand, interacts with GRB2 or PLCG2 and induces phosphorylation of MAPK1, MAPK2, FAK/PTK2 or RAC1. MERTK signaling plays a role in various processes such as macrophage clearance of apoptotic cells, platelet aggregation, cytoskeleton reorganization and engulfment. Functions in the retinal pigment epithelium (RPE) as a regulator of rod outer segments fragments phagocytosis. Plays also an important role in inhibition of Toll-like receptors (TLRs)-mediated innate immune response by activating STAT1, which selectively induces production of suppressors of cytokine signaling SOCS1 and SOCS3.Mer is known to bind Gas6, Protein S, Tubby, Tubby-like protein 1 (Tulp1), and Galectin-3. Upon binding ligands via the Ig-like motif, Mer is dimerized to trans-autophosphorylate the kinase domain to induce downstream signaling. It has been shown that Mer signaling in macrophages induces M2 polarization, which promote tumor growth, metastasis and evasion of anti-tumor immunity in tumor microenviroment. Inhibition of Mer, especially on leukocytes and macrophages, is an effective anti-cancer therapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 81495002018

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
Plant ecology
Boise, US
★★★★★ 5
Love my Yamahas
Set name: 5.1 Receiver
RX 385 replaces my much-loved 10 year old RX 375, which I inadvertently fried while experimenting. The 385 has some newer features, including bluetooth. The old model and this both use the handy YPAO function to tune the audio speakers' depth of field to the listening environment. It's a broadcast mic that you just plug into the front of the receiver for a few seconds to determine each speakers' distance from viewer. Kind of a sonic echo measurement of seating to speaker. It's a foolproof, remarkably clever, timesaving gizmo. The YPAO mic is absolutely included with this unit, looks like a little plastic cone. Also important to me, Yamaha has replaced the old spring clips for rear/side speakers, which are now the better screw and cap posts, as they have always been for the two front speakers. I recommend rocketfish HDMI 4k/8k cables to connect this receiver to your tv and to whatever other components you want, such as a bluray. Sound quality is excellent if your speakers are good. (I like KEFs.) Of course you may prefer wireless speakers, but I'm already committed to wired ones. I used rocktfish banana plugs to connect my speaker wires to the RX 385 receiver's speaker posts. Neat and clean. With a choice of 2 front, 2 rear, 1 center speaker, plus one coaxial plug in for a subwoofer, your movies and programs are going to sound far more detailed and staged than you'd get from the tv or a sound bar. It's a more immersive and compelling experience. (I use only 2 fronts and 2 rears and don't feel I'm missing anything.) Yamaha receivers and other components are my favorites: relatively inexpensive, well designed, solidly built, and not fussy to install. If you find yourself in a pickle there are a couple of helpful youtube videos. I find with the RX385 again that Yamaha does not disappoint me.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2023
P
Verified Purchase
phil
Grantham, US
★★★★★ 5
Great unit
Set name: 5.1 Receiver
Works great, was worried about having my hdmi run through it thinking id have to use it all the time but leaving it off the signal still goiles through to the TV. Very rleasy to hook up and very easy to use.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 8, 2026
R
Verified Purchase
Ron R
Fort Morgan, US
★★★★★ 5
Outstand Product!! 😉
Color: 14AWG-1 Lead
This is my second (at least) Nilight wiring harness. I wanted to re-do the lights on my Rhino 660. This makes it SO EASY! 👍🏼😉 And a hell-of-a-deal!! All I had to get was a "reamer" drill bit to enlarge the switch holes on my dash. Run the wire, attach the ends to the light, switch & power source, all done. I did add "shrink tubing" to my connections to add an extra layer of insulation/weatherproofing. 👍🏼
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 16, 2025
D
Verified Purchase
Daniel T.
Pawtucket, US
★★★★★ 5
Definitely a good buy very professional craftsmanship
Color: 14AWG-1 Lead
As a retired master technician for Honda and all makes and models of automobiles this harness is a cut above the others is put together immaculately and anyone that can put a wire through the firewall I purchased my light bar to harbor freight 22 in great lighting but their harness kit was 56 bucks I paid under 24 this and it looked identical except the switch on this is actually much more appealing cosmetically and works well functionally just had to drill a hole in one of the blanks 4 switches in my truck made it fit perfect and has worked flawlessly since I put it in a couple weeks agodefinitely do your homework sometimes I find great deals at harbor freight that nobody can touch on Amazon but then other times vice versa Amazon has a great product at a great price compared to harbor freight in other retailers
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 22, 2020
F
Verified Purchase
FrugalDad
Louisville, US
★★★★★ 5
Perfect for roof LED light bar
Color: 14AWG-1 Lead
This worked great for wiring a 50" LED light bar to the roof of my SUV. This kit conveniently includes a relay, switch with backlight, and fuses. I used a step bit to drill the pilot hole for the switch and worked my way up until it was the right size. I zip tied the excess wire and it made for a clean install. My only complaint is that the ring terminals were too large for the battery but it was easy to crimp smaller ones on.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 13, 2022

recommand products