Pay in installments of $62.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 22 - Jul 27
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
SLAMF7/CRACC/CD319 mFc Chimera Protein, MouseProduct Specification Species Mouse Synonyms SLAMF7, CRACC, CD319, CS1, 19A, FOAP 12 Accession Q8BHK6 Amino Acid Sequence Ser23 Gly224, with C terminal Mouse IgG2a Fc
Product Specification
| Species | Mouse |
| Synonyms | SLAMF7, CRACC, CD319, CS1, 19A, FOAP-12 |
| Accession | Q8BHK6 |
| Amino Acid Sequence | Ser23-Gly224, with C-terminal Mouse IgG2a Fc SGTLKKVAGALDGSVTFTLNITEIKVDYVVWTFNTFFLAMVKKDGVTSQSSNKERIVFPDGLYSMKLSQLKKNDSGAYRAEIYSTSSQASLIQEYVLHVYKHLSRPKVTIDRQSNKNGTCVINLTCSTDQDGENVTYSWKAVGQGDNQFHDGATLSIAWRSGEKDQALTCMARNPVSNSFSTPVFPQKLCEDAATDLTSLRGIEGRMDPEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK |
| Expression System | HEK293 |
| Molecular Weight | 58-72kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | Mouse Fc Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1、Lee J K. et al. (2004) Molecular and functional characterization of a CS1 (CRACC) splice variant expressed in human NK cells that does not contain immunoreceptor tyrosine-based switch motifs. Eur J Immunol. 34(10): 2791-2799. 2、Tassi I. et al. (2005) The cytotoxicity receptor CRACC (CS-1) recruits EAT-2 and activates the PI3K and phospholipase Cgamma signaling pathways in human NK cells. J Immunol. 175(12): 7996-8002. 3、Lee J K. et al. (2007) CS1 (CRACC, CD319) induces proliferation and autocrine cytokine expression on human B lymphocytes. J Immunol. 179(7): 4672-4678. 4、Cruz-Munoz M E. et al. (2009) Influence of CRACC, a SLAM family receptor coupled to the adaptor EAT-2, on natural killer cell function. Nat Immunol. 10(3): 297-305. |
Background
SLAM family member 7 (SLAMF7) is also known as CD2-like receptor-activating cytotoxic cells (CRACC), Membrane protein FOAP-12, CD antigen CD319, Novel Ly9, Protein 19A, which is a single-pass type I membrane protein and a member of the CD2 family of cell surface receptors. Mature mouse CRACC consists of a 202 amino acid (aa) extracellular domain (ECD) with one Ig-like V-set domain and one Ig-like C2-set domain, a 21 aa transmembrane segment, and an 88 aa cytoplasmic domain with two immunoreceptor tyrosine-based switch motifs ITSMs. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Mediates natural killer (NK) cell activation through a SH2D1A-independent extracellular signal-regulated ERK-mediated pathway. Positively regulates NK cell functions by a mechanism dependent on the adapter SH2D1B. In addition to heterotypic NK cells-target cells interactions also homotypic interactions between NK cells may contribute to activation. However, in the absence of SH2D1B, inhibits NK cell function.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.2 ★★★★★
Based on 6 reviews
Sort
Product Reviews
★★★★★ 5
Absolutely love this hand cream!
Scent: Lemon Cream, Size: 3.3 Ounce (Pack of 1)
I have really dry skin, partly because I take a chemo med for autoimmune issues that really dehydrated me no matter how much water I drink. Other lotions I bought were either too greasy and just sat on the surface of my skin OR simply weren’t hydrating enough. But this hand cream is my absolute favorite now. It is super moisturizing, but is also fully absorbed by my skin very quickly. It’s honestly impressive. There was a nearly immediate, extremely noticeable difference in the condition of my skin after I started using this.
This lotion even seemed to solve a related issue I was having where my dead skin cells just refused to be shed, no matter how much I scrubbed in the shower or how much of my normal body lotion I applied. Sorry if it’s TMI, but literally minutes after applying this for the first time on my arms, I was able to basically just wipe off that dead layer of my skin, revealing much softer and more supple skin underneath. This is an issue that has been plaguing me for over a year that was seemingly solved in one day.
Additionally, I find that the scent is very pleasant. It weirdly reminds me of Froot Loops at first, but in the best way possible. It’s just got that nice citrus-forward, sweet fragrance, and as it dries down the scent gets mellower and more creamy as the lemon settles into the background. It’s definitely got a gourmand scent imo, but it’s not cloyingly sweet or artificial. It just genuinely smells like madeleines with lemon curd or something.
I think the Shea butter is largely responsible for the creamy, vanilla-like scent that develops after a couple minutes. It’s very nice, I find myself smelling my hands for like an hour after I apply it because it’s just so delicious! It doesn’t have a strong throw at all once absorbed, the scent fades to only be detectable if someone is inches from your skin, so it hopefully shouldn’t annoy people around you unless they are severely intolerant to fragrance.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2022
★★★★★ 3
I would not recommend
Scent: Coconut, Size: 3.3 Ounce (Pack of 3)
First problem…the product description says “scent coconut” which is a false description. I would describe the scent as “medicinal” and of course reminds me of being in a hospital. Second problem…a reviewer called this item non greasy. This product is very greasy/oily and is slow to absorb. The good thing about this item is that its effective for dry skin.
Having tried a couple dozen hand creams, my top 3 in ascending order are…
3. Okeffees working hands. Unscented . If you’re working outside, landscaping, etc, this is excellent.
2. Ahava. Strong masculine scent (musky). Works great. Not greasy or oily. Fast drying. The only negatives are: it’s not always in stock, it’s expensive.
1. Jack Black hand healer. Slight scent from eucalyptus (smells similar to menthol). Works great. Not greasy. Fast drying. It’s expensive however significantly less expensive than Ahava. It’s also much easier to find in stock.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 16, 2025
★★★★★ 5
I really like it Good coconut smell and a nice lotion texture
Scent: Coconut, Size: 3.3 Fl Oz (Pack of 1)
I really love this lotion I will most definitely buy it again I think it makes me smell really good I even had somebody ask me what I was wearing lol
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 25, 2026
★★★★★ 5
Makes my hair shine.
Size: 3.38 Fl Oz (Pack of 1)
This product makes my hair smell good and shiny. You only need to use a small amount for results. I am sure my hair will grow since oil is good for your hair.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
★★★★★ 5
Natural solution
Size: 3.38 Fl Oz (Pack of 1)
Excellent moisturizer! Has a light fragrance and not oily. Only used for a few days so can't attest tolong term benefits.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026