SKU: 82404666948

SARS-CoV-2 (COVID-19) S1, His tag

Sale price$144.00 Regular price$160.00
Save 10%

Pay in installments of $40.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 21 - Jul 26

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

SARS-CoV-2 (COVID-19) S1, His tagProduct Specification Species SARS CoV 2 Synonyms Spike glycoprotein, S glycoprotein, E2, Peplomer protein Accession P0DTC2 Amino Acid Sequence Protein sequence (P0DTC2, Val16 Arg685, with C His tag)

Product Specification


Species SARS-CoV-2
Synonyms Spike glycoprotein, S glycoprotein, E2, Peplomer protein
Accession P0DTC2
Amino Acid Sequence

Protein sequence (P0DTC2, Val16-Arg685, with C-His tag) VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR

Expression System HEK293
Molecular Weight Predicted MW: 76.7 kDa Observed MW: 95-130 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Severe acute respiratory syndrome coronavirus 2 (SARS‑CoV‑2) is a strain of coronavirus that causes COVID-19, the respiratory illness responsible for the COVID-19 pandemic. SARS-CoV-2 has four structural proteins, known as the S (spike), E (envelope), M (membrane), and N (nucleocapsid) proteins; the N protein holds the RNA genome, and the S, E, and M proteins together create the viral envelope. Coronavirus S proteins are glycoproteins and also type I membrane proteins (membranes containing a single transmembrane domain oriented on the extracellular side). They are divided into two functional parts (S1 and S2). Spike is the protein responsible for allowing the virus to attach to and fuse with the membrane of a host cell; specifically, its S1 subunit catalyzes attachment, the S2 subunit fusion. The S1 region of the spike glycoprotein is responsible for interacting with receptor molecules on the surface of the host cell in the first step of viral entry. S1 contains two domains, called the N-terminal domain (NTD) and C-terminal domain (CTD). The CTD is responsible for the interactions of SARS-CoV-2 with angiotensin-converting enzyme 2 (ACE2).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 82404666948

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
Nat Dubs
Natrona Heights, US
★★★★★ 4
Solid Omegaverse!
Format: Kindle
4.5 strong stars!🌟 Overall great story solid omegaverse. I love how they’re fighting their instincts. Lots of spice, TONS of slick and heated moments. **Slight spoiler sort of** I was nervous reading this for pretty much one reason and that was the other “O” listed. I knew it wasn’t another female and I would have been happy/fine if it was but the concern lay in not knowing or being guaranteed the smexual preferences of our three alphas so realistically this gave me anxiety on how the dynamic would work. Anyone who has read omegaverse knows there’s usually one omega in each pack. My fear was the male omega connecting only with the female omega and that dynamic doesn’t wholly work for me. To me, the male omega needs the alphas as well so I was relieved with how this turned out.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2025
L
Verified Purchase
LaChante Anderson
Fort Morgan, US
★★★★★ 5
Good plot but definitely slow burn
Format: Kindle
⭐️⭐️⭐️⭐️.5|🌶️🌶️🌶️🌶️ (not a ton of spice scenes for an Omegaverse) The plot, character development, scene progression, and action throughout the story was done really well. I did wish there was better pacing for the spice. I felt like the big spice was really rushed. During some scenes the story was a little hard to follow. I think some parts could’ve been cut. Overall I would read more from this author! 💖
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2025
A
Verified Purchase
Amazon Customer
Pawtucket, US
★★★★★ 5
omg loved the story
Format: Kindle
I’ve been in a reading slump DNFing so many books and finally found a story to keep me captivated… now with that though there were still some parts that were a bit of a struggle like Tatums struggle with the past trauma she dragged that on for ever I get it pasts are hard to overcome sometimes. But honestly it was easy to get over it falling in love with all these little psychos 🤣🤣🤣 absolutely loved Kodi’s obsession with getting Easton even though he doesn’t know him but smells brownies everywhere and missing the mark it was hysterical.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 23, 2025
L
Verified Purchase
Lisa Maddison
Whiting, US
★★★★★ 4
Omegaverse with rival families.
Format: Kindle
Tatum is trying to raise enough money to treat her omega mother who has fallen catatonic due to the death of her mate. To make the money she needs she agrees to work at a gentleman's club scantily dressed. There she meets the twin Hayes brothers, Declan and Kodiak, what she doesn't know is that their younger half brother is the high school sweetheart that ghosted her after helping with her first heat. Tatum also meets Easton, the mysterious male omega that pops into her life but she finds herself strongly attracted to. I enjoyed all the characters, even those that were not major characters, the plot was good, the storyline was well done. I would recommend this book if you liked Omegaverse stories, mafia storylines, and good romance with why choose.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 1, 2025
T
Verified Purchase
T_Mich13
Alexandria, US
★★★★★ 5
Loved it!
Format: Kindle
Who doesn’t love morally grey men obsessed with their omega who isn’t afraid to call them out on their unacceptable behavior and make them grovel? Tatum really is a survivor through and through. She is willing to do anything to get her mother the help she needs, even deal with the man her broke her heart. If you love brothers playing jokes, crazy stabby omegas and rich men being told no, you will enjoy this book. Great spice and great ending.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 5, 2025

recommand products