SKU: 1893651411

Angiopoietin-2(275-496) His Tag Protein, Human

Sale price$216.00 Regular price$240.00
Save 10%

Pay in installments of $60.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Angiopoietin-2(275-496) His Tag Protein, HumanProduct Specification Species Human Synonyms Angiopoietin 2, ANGPT2, AGPT2, ANG2 Accession O15123 Amino Acid Sequence Lys275 Phe496, with N terminal 8*His HHHHHHHHGGGSKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF Expression System HEK293 Molecular Weight 30 33kDa Purity >95% by

Product Specification


Species Human
Synonyms Angiopoietin-2, ANGPT2, AGPT2, ANG2
Accession O15123
Amino Acid Sequence

Lys275-Phe496, with N-terminal 8*His

HHHHHHHHGGGSKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Expression System HEK293
Molecular Weight 30-33kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Hu B. et al. (2009) Angiopoietin-2: development of inhibitors for cancer therapy. Curr Oncol Rep. 11(2): 111-116.

Background

Angiopoietin-2 (ANG 2, or ANGPT2), is a member of the ANG family, which plays an important role in angiogenesis during the development and growth of human cancers. Both ANGPT-1 and ANGPT-2 appear to bind to the tyrosine kinase receptor, Tie-2, found primarily on the luminal surface of endothelial cells. ANG-2's role in angiogenesis generally is considered as an antagonist for ANG1, inhibiting ANG1-promoted Tie2 signaling, which is critical for blood vessel maturation and stabilization. ANG-2 modulates angiogenesis in a cooperative manner with another important angiogenic factor, vascular endothelial growth factor A. Genetic studies have revealed that ANG-2 also is is also critical in lymphangiogenesis during development. ANG-2 has multiple physiologic effects that regulate vascular tone, hormone secretion, tissue growth and neural activity. Several reports indicate that ANG-2 can induce neovascularization in experimental systems due to the expression of different growth factors such as angiopoietin 2, vascular endothelial factor, and its receptor, fibroblast growth factor, platelet derived growth factor, transforming growth factor beta and epidermal growth factor. In addition, ANG-2 is strongly expressed in the vasculature of many tumors and it has been suggested that ANG-2 may act synergistically with other cytokines such as vascular endothelial growth factor to promote tumor-associated Angiogenesis and tumor progression.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 1893651411

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
P. Lucas
Birmingham, US
★★★★★ 5
A treasure that desperately needs a reboot.
I love this mouse. I greet it every morning and give it warm caresses as I drink my morning coffee. I catch myself staring longingly at it daydreaming of using it sitting on a beach sipping a drink with an umbrella. I call her Bridgette. Is she perfect? Probably not - otherwise they'd still be a lot more popular. Is she perfect for me? Yeah. She is. So first the bad and then the good: This mouse is big. For folks with normal to big sized hands, that's a win in a world of tiny mice built for Hobbits. If you have the hand size of a large doll could you still manage it? Yes. It's not THAT big. The surface finish is...temporary. Dynamic. Fluid. I think of it more as patina at this point. Most of the painted surfaces (except for the left click button) on mine are still the same color they were when I bought it. I seem to remember a "soft touch" satin coating on the black parts but that has worn off mine years ago. She still turns heads though. Some people say that these mice have reliability issues. We've been together for a good 17 years and she's still going strong. There was a scare recently where her buttons stopped working but a careful dose of electrical contact cleaner in the switches and a few hours rest and she was right as rain. She's not bullet-proof but hopefully will be around another score or so before parting for good. What I love about this mouse is the feel. It's just right. Trackball people are a finicky group and rarely do we find something that suits us to little complaint. The size of this mouse fits me perfectly. All the buttons are where they should be, I don't have to strain and move and fight to make stuff happen. There's enough flexibility in programming the buttons you can set it to do most tasks easily with one click. It's not so complex that it introduces unwanted drama in your life trying to figure out the minutiae of endless setup options. The trackball is perfectly placed. It's far enough forward my fingertips don't have to hunt for it and just enough to the side that I don't have to twist my wrist to reach it. I can swipe easily from one side of the screen (or across screens) without a thought but still have enough control to be precise when needed. All without straining my wrist. I like the action of mouse clicking left/forward/back with my thumb as it's more natural than the thumb-driven trackballs. I either suffer from twitchy thumb or it's just a bad design for precise movement. The right click button is naturally placed just to the underside of the trackball and feels effortless to click with my ring finger. The scroll wheel is small but cushy and comfortable. There are soft indents to the scrolling so it doesn't get away from you. If you prefer the smooth scrolling feel the "cruise" buttons above and below get that done easily. The drag lock button can come in handy if you're constantly copying multiple files back and forth. I generally don't so it's easily remapped in the software. Battery life is really good. I usually go several months on a set of cheap AA's. It has an auto sleep function instead of a power switch which is handy. The nice thing about AA batteries is that you can easily find them anywhere. I think that's one of the main reasons mine has lasted so long. Dear Logitech or any other company that may stumble across this - please bring this model back with a reboot. People obviously loved it and they sell like hotcakes. I've seen used ones go for upwards of $400 now. Surely there's some profit in doing another run of these beauties!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2021
M
Verified Purchase
M. Turner
New York, US
★★★★★ 5
Simply the best input device I've ever used
I've been a long time fan of trackballs - most especially and specifically those made by Logitech. About five years ago I started having pain in my wrists from the constant side-to-side motion of using a mouse. I picked up a Logitech Marble Mouse and loved it for years. It instantly helped by wrist issues and I didn't get so strained and hardly ever got soreness. The only thing I didn't like was that there weren't enough buttons. I envied things like a scroll wheel found on regular mice. The thumb trackball was horrid in my thought (all that stress where your thumb meets the wrist; Ouch!) but had the extra buttons I longed for. Then this one came along. Wow. I saw it in the store and I'll admit, I was a bit intimidated at first. Did I need a cordless? Could I get used to moving it with my hand in a slightly different position? And I know I wanted buttons, but woah, there's a LOT of buttons on it! I played with it and daydreamed about it. I finally ended up getting it for my birthday in May 2003. It honestly did take me a few days to adjust to the change (even from one Logitech trackball to another), but now I can't imagine ever going back. The sheer convenience of being able to not only left-click/right-click, but scroll AND easily go Forward and Backward through webpages with a click of a button amazes me everytime. Trackballs already cut down the amount of round-about pointing you need to do by making it much smoother and easier because of less motion required, but this cuts it down way more then that. Some thoughts from other reviews: *Lefties -- I'm sorry, but it really is designed for a right-hander. Like most mice/trackballs on the market today, they aim for the majority. It's usable on short term for lefties (my boyfriend's a southpaw and he can maneuver it, but couldn't really use it every day, day-in/day-out). HOWEVER, a nice option is the Logitech Marble Mouse since it is neither left nor right hand specific. * Cordless issues -- I've had ZERO interference with it and I have a USB Wacom tablet as well as digital camera hookups and other usb items in my usb hub. NEVER a problem. The manual recommends that if you have problems, move the receiver away from the monitor. Mine sits two or so feet away and works perfectly. * Battery life -- WONDERFUL. Mine went for about five months or so on the original batteries it came with. And I am a hard-core user, driving my trackball way over ten hours a day. The program even warns you on-screen that your batteries are getting low. How cool is that? You don't have to wait until things die leaving you without a mouse, wondering what went wrong - it tells you! * Weight of ball -- I have to say that one of the best aspects of the Logitech trackballs is that the ball spins VERY smoothly and easily. It's also not heavy. This sounds weird until you try one of the HORRID Kensington ones which has such a heavy ball that you literally get fatigued fingers from trying to push the darned thing around the screen. It's such a battle with inferior ones whereas, with the Logitech ones, it's easy. I can zoom around the screen as fast as I wish with the slightest touch of my fingertips (*note: the speed and such can also be edited if you like a slower cursor, but it still will have the lightweight Logitech is known for) * Range of Use -- I agree with another user here - this thing has a range that's far more then you'd need. I sometimes use it on my lap and can stand up and control it from several feet away. * Cleaning -- IMPORATANT. Every now and then, pop the ball out (by pushing from underneath) and clean the gunk which gets on the points the ball rests on. It will help keep your ball rolling smoothly. In sum: ergonomic, comfortable, works great and a real Logitech winner. Well worth the cost.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 6, 2003
S
Verified Purchase
Stanley Chen
Cuba, US
★★★★★ 3
Great, yet, not so great
I never bother leaving reviews, but this one gave me an opinion that was strong enough that I had to say something. Much like many other reviews out there, a lot of people complain about the placement of the buttons. Actually I think for the most part everything is fine except for the scroll wheel and the default left click. My problem with those two is, if you're using your index finger to use either feature, you have to really stretch your finger outwards to access it. If you tilt the whole device so that it reaches more easily, then the thumb buttons are now at an odd position. I do have to say though, I originally thought that a non vertical hand position would kill my wrist but surprisingly it didn't. It didn't save my wrist either. But creating finger pains isn't exactly a good alternative due to the uncomfortable positioning. Yes I know you can remap the buttons to different functions but that's settling for less as that means you're opting out on using the uncomfortable buttons. A quick little history on my previous devices. I've used regular mice like everyone else before all these problems creeped up on my hands. The most comfortable regular mouse for me is the logitech mx revolution. But eventually using that started to cause pain. I then moved onto the evoluent vertical mouse 3. That mouse is great and I still use it depending on what I need it for. However I recently ordered the zero tension mouse and I find that for overall usage, that one is the most comfortable since your wrist is at its most relaxed state. No twisting of any kind. Not only that, the fingers curl naturally along the device to reach the buttons. Some people palm their mice leaving their fingers straight, but for others with longer fingers it's a bit difficult to use a mouse without curling your fingers backwards a bit to accommodate positioning. What is the whole point of that long paragraph? This trackman doesn't allow your hand to be in a resting state and *may* cause more strain, or a different type of strain in addition to whatever problem you may already experience. While it sounds like I'm claiming that this is the worst pointing device ever, I'm just stressing on the bad points. It's definitely a solid piece of technology. Doesn't feel cheap, the ball is super easy to clean along with the insides where some dust may collect. All the buttons feel solid. Overall it's got heft so that the whole thing doesn't slide around during use. But build quality and maintenance takes a backseat if comfort isn't there.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 22, 2010
M
Verified Purchase
Mesa Mountain Gal
Pawtucket, US
★★★★★ 4
Macho Macho Mouse!
This is the biggest mouse ever! At least the biggest I have ever seen or held. It is more like a large rat than a mouse. It was a bit too large for my petite/medium sized hand (I should have read the dimensions more carefully). I did not like the long cord it came with, and the device at the end of it for wireless capability - not very portable. The lock button malfunctioned and just quit working. The scoll buttons are too close together for me and too small. The ball was nice and smooth, but it did not ease the pain in my hand as I had expected. But I have inflamation issues. If a smaller one were available, it might have worked better for me, but the design/layout of some buttons didn't work for me. I surmise that this mouse works superb for men or women with large hands. But it was just not a good fit for me or my work area, and it malfunctioned. I ended up buying and loving... My husband, who is utterly finickly about his mice, actually found this one comfortable and easy to use. The biggest reasons for a trac ball mouse are 1) it works nicely by my side when laptopping on my bed-top - no need to move the mouse around, only the trac ball. 2) The ball and buttons do not cause inflammation in my hands.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 12, 2009
L
Verified Purchase
logodaedaly
Houston, US
★★★★★ 5
Great for radiology
I work intensively with computers. In radiology, the number of data points to process quickly is multifarious: dictation software, PACS, and workstations, 4 screens, etc. Volume is also inherently high. I've used this product for two-years and am very satisfied. At times, I was finding wrist fatigue a bit of an issue with the classic two-button mouse with a center roller. My symptoms were nothing serious, just irritation at the end of each day from "clicking". I purchased this roller as a trial, to see if I get any relief. It worked just as I had hoped. I have no symptoms during or at the end of the day. I not will not go back to just a mouse. Build is very comfortable and solid. Ease of use. For me, it is a 5*, but you should know that it does have quite of bit of complexity. As you can see, it has any number of buttons--which I was specifically looking for. I find that these myriad buttons are very functional and easy to use in practice. You just have to map out what are high volume or repetitive motions/keystroke actions. Now I love Macs and their simplicity (and this trackball also works nicely with them), but their mouse is too stripped down for my needs. I am someone who uses keyboard shortcuts whenever possible to speed things up. And again, in my business, speed and accuracy are critical. I already was already maxed-out with mere two-button mouse. This trackball allows me to custom assign functions and keyboard assignments. For instance, page-up and down are assigned to arrow buttons on the trackball. Now when I'm on a website or scrolling through ultrasound exams, I just click rather than moving to the keyboard. To initiate a case dictation is typically alt-8: now this function is tasked to a button on the trackball. Clicking the middle mouse scroll wheel is now assigned to mini-scroll wheel on the trackball. And so on. I worried that the trackball would have trouble interfacing with the programs I used. It essentially had no problem. It was recognized across the board. There has been only one function that still requires a mouse: a shortcut I use for zooming on the PACS is to hold down the option key and spin the center wheel. For some reason I am unable to replicate this function. Because the zooming shortcut is something I use all the time, the mouse stays on my desktop next to the trackball Which brings up another nice feature of this product: it can co-exist with a mouse. I plug the wireless transmitter into the front USB port and leave the mouse connected in back. I can use either device whenever I like. If a colleague comes over to review a case, they never know what to do with the trackball so I just move it out of the way and they use the mouse. If I move to a different workstation, I just unplug the transmitter and move and plug it into the next computer. The trackball will need to be configured as a first-time each time you start on a new computer, but done the profile will remain. There is logitech software that needs to be installed, but all of the mice are logitech, so the software for adjusting the trackball is for me already in place. My productivity is higher and I have less frustration thanks to this device. For not only does the device allowing me to short-circuit and subsume common tasks, but it it simply much faster than a mouse. You can adjust the speed of cursor tracking and you can also embellish cursor movement with an accelerator. With multiple large, high-resolution monitors, this is very rewarding. Everything is faster. When I have to review a case on a colleague's workstation with a mere mouse, I am given a glimpse of how I used to work: the mouse is sluggish and I have to do a lot of wrist movement. Sure, the conventional mouse can itself be accelerated, but you still have the basic fact that you have to keep moving your wrist to cover four screens and to scroll through hundreds of images. I appreciate afresh that I am using a trackball and not a mouse. Lastly, I do have to give high credit to logitech itself. 6-12 months into purchase, the buttons I had assigned to serve as "page-up" and "page-down" were not responding 100% of the time. Sometimes that signals that the AA batteries are wearing out, but even with new batteries the issue persisted. I called logitech and they switched out the device without any questions. Really top-flight service. The replacement is going on strong after 1 year. So in short, if you are considering a trackball, get one. This one is I think the top of the line. If you don't need to extreme functionality, consider the Logitech Trackman Marble Mouse which has fewer buttons but works on the same principle (I actually use the marble mouse at home, because my at-home use is much lighter). I have read about "review mills" that churn out praise or scorn. I find Amazon's reviews to be a great source for separating wheat from chaff. It has a critical mass of users and reviewers. That said, when I was looking for a trackball, however, I did not see a review that was on-point for my niche needs. Hopefully this review will fill that lacuna.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2011

recommand products