SKU: 1974062818

Rhesus macaque IFNA13 Protein, His Tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Rhesus macaque IFNA13 Protein, His TagProduct Specification Species Rhesus macaque Synonyms Interferon, alpha 13 Accession A0A5F8AJA6 Amino Acid Sequence Protein sequence (A0A5F8AJA6, Cys25 Leu182, with C His Tag) CDLPETHSLDNRKTMMLLAQMSRISPSSCLMDRHDFGFPQQEFDGNQFQKAPAISVLHELIQQTFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQQERVGETPLMNADSTLAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSFSLSTNL Expression System HEK293 Molecular Weight Predicted MW: 20 kDa Observed MW: 17 kDa Purity 95% by SDS PAGE Endotoxin <1EU

Product Specification


Species Rhesus macaque
Synonyms Interferon, alpha 13
Accession A0A5F8AJA6
Amino Acid Sequence

Protein sequence (A0A5F8AJA6, Cys25-Leu182, with C-His Tag) CDLPETHSLDNRKTMMLLAQMSRISPSSCLMDRHDFGFPQQEFDGNQFQKAPAISVLHELIQQTFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQQERVGETPLMNADSTLAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSFSLSTNL

Expression System HEK293
Molecular Weight Predicted MW: 20 kDa Observed MW: 17 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

IFNA13, or Interferon Alpha-13, is a member of the type I interferon (IFN) family, a group of cytokines crucial for innate immunity against viral infections. It signals through the shared IFNAR1/IFNAR2 receptor complex to activate the JAK-STAT pathway. This leads to the expression of interferon-stimulated genes (ISGs) that establish an antiviral state in cells. IFNA13 is implicated in the early immune response. Research suggests its expression and potential roles may vary in different pathological contexts, including viral diseases and certain cancers, warranting further investigation into its unique biological activities.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 1974062818

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Ken
Omaha, US
★★★★★ 5
Great frother/stirrer especially for the price.
Color: Black, Size: Rechargeable
Best one available. Have used cheap ones from the store that work pretty good, but batteries are a pain. This is rechargeable and it has a push button that allows you to start it right away without having to turn it on to start it kind of like a power drill. If you start to press it it goes slow the harder you press the faster it goes. The different attachments are great. We use it for both coffee frothing as well as mixing up electrolyte drinks with water with the included mixing attachment. Crazy powerful and easy to use.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
T
Verified Purchase
Techie
Houston, US
★★★★★ 5
Strong motor. Works great
Color: Black, Size: Rechargeable
I really like this frother. The fact that it’s variable speed, rechargeable, and can spin at a high rate are all great features. I use it to blend collagen powder and cream into my coffee every morning. Also sometimes use it to Blend drinks. Strong motor. Like that the whisks are removable for cleaning and that it comes with different ones.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2026
J
Verified Purchase
John Wagner
Grantham, US
★★★★★ 4
Works well, long use on single charge, high torque - be careful when starting
Color: Black, Size: Rechargeable
Not the most inexpensive powered whisker bur I've used other Typhor products and found them reliable for the task designed. I fell they don't cheap out on the rechargeable battery so I don't fell they will catch fire, as we are hearing about from other cheaper rechargeable items. I liked 2 things about this model the speed control is by a pressure single switch which I can control, not just pick speed 1,2,3. The swappable tips allow for different uses. I don't drink coffee but use the item to whisk eggs for an omelets and it has the torque to mix them without effort. In Fact need to only use half power else it will splatter out of my mixing vessel.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2026
M
Verified Purchase
Mike from San Diego
Waukegan, US
★★★★★ 5
I love it!
Color: Black, Size: Rechargeable
This thing works great! It holds a charge for a long time. I love that it has different attachments. I use it mainly for mixing powder into my drinks. It is very powerful. The speed is adjustable too. It feels good to hold too. It lights up when you squeeze the trigger and when it starts losing charge, the light bar gets shorter. I highly recommend it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2026
K
Verified Purchase
KindleDiva
Port Orchard, US
★★★★★ 5
Perfect all-around frother, stand keeps it nice and neat on the counter within easy reach.
Color: Black, Size: Rechargeable
Rechargeable, lightweight, variable speeds and optional whisks all make this the perfect item for your kitchen. You can quickly froth milk for your coffees, whip a small batch of whip cream, and even make mug cakes with the hook attachment. The price is very compatible with the competitors, but the ease of use makes this a top choice. The variable speeds makes it much better to control than the push button ones. When you let go of the pressure switch it turns off, no need for a dedicated on-off switch. Having the pressure switch on the top makes it extremely easy to use! It fits very comfortably in the hand and with the metal stand, looks quite nice on the counter, ready to use at any time. I highly recommend this InstaWhisk!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026

recommand products