SKU: 21951038540

Human PTH , His tag

Sale price$166.50 Regular price$185.00
Save 10%

Pay in installments of $46.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human PTH , His tagProduct Specification Species Human Synonyms Parathormone, Parathyrin Accession P01270 Amino Acid Sequence Protein sequence(P01270, Ser32 Gln115, with C 10*His) SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQGGGGSHHHHHHHHHH Expression System CHO Molecular Weight Theoretical: 11. 1kDa Actual: 10, 12kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer

Product Specification


Species Human
Synonyms Parathormone, Parathyrin
Accession P01270
Amino Acid Sequence

Protein sequence(P01270, Ser32-Gln115, with C-10*His) SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQGGGGSHHHHHHHHHH

Expression System CHO
Molecular Weight Theoretical:11.1kDa Actual:10, 12kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Parathyroid hormone (PTH), also called parathormone or parathyrin, is a peptide hormone secreted by the parathyroid glands that regulates the serum calcium concentration through its effects on bone, kidney, and intestine. PTH influences bone remodeling, which is an ongoing process in which bone tissue is alternately resorbed and rebuilt over time. PTH is secreted in response to low blood serum calcium (Ca2+) levels. PTH indirectly stimulates osteoclast activity within the bone matrix (osteon), in an effort to release more ionic calcium (Ca2+) into the blood to elevate a low serum calcium level. Disorders that yield too little or too much PTH, such as hypoparathyroidism, hyperparathyroidism, and paraneoplastic syndromes can cause bone disease, hypocalcemia, and hypercalcemia.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 21951038540

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 11 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
A.pappy
Draper, US
★★★★★ 5
Keeps my dog busy and actually holds up
This jigsaw-style dog toy has been a game changer for keeping my dog entertained. The design is super versatile—you can spread peanut butter (or yogurt, wet food, etc.) into the grooves, and it keeps them busy licking for a long time. What I like most is that it’s not just a lick mat—it’s also a durable chew toy. The material feels strong and holds up really well, even with a dog that usually destroys toys pretty quickly. Toys made from rubber or similar materials tend to last longer and are safer for chewing compared to softer options. The grooves and compartments make it a little more challenging (in a good way), so it takes my dog longer to get through the treats. I’ve even tried freezing peanut butter inside, and that keeps them occupied even longer. Lick-style toys like this are great for slowing dogs down and keeping them calm and engaged. It’s also been really helpful during times when I need a distraction—like when I’m busy, cleaning, or even during grooming. Pros: • Durable and holds up to chewing • Can use peanut butter, yogurt, or other soft treats • Keeps dogs busy for a long time • Helps with boredom and anxiety • Freezable for longer use Cons: • Can get messy depending on what you put in it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 2, 2026
M
Verified Purchase
Michelle
Houston, US
★★★★★ 5
Hubie gives it two paws up !!
Hubie loves this he’s a Great Dane and a busy chewer.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
N
Verified Purchase
N.
Pawtucket, US
★★★★★ 1
My dog says no
Big block with a pattern on it...dog has absolutely no interest in it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2026
K
Kel
Lowell, US
★★★★★ 3
Doesn't hold their attention
I have 5 dogs, and only one of them seems to actually want to play with these toys, and even he's not that enthused. And he'll literally play with anything. I think it's the shape that's unappealing. My smallest sniffs and licks it, gives it a little nibble, hoping it will actually taste like peanut butter, but once he realizes it's just plastic he turns his nose up. They are solid, durable toys that should hold up to power chewers, but none of my power chewers care enough to bother for more than a few minutes. Size wise they're perfectly suited for the sizes intended.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 23, 2025
I
Verified Purchase
It’s me
Chelsea, US
★★★★★ 5
Tough Chew Toy
Great chew toy! She loves it more peanut butter spread in it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 23, 2026

recommand products