SKU: 23566562288

Human IL-11 Protein, His tag

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-11 Protein, His tagProduct Specification Species Human Synonyms Interleukin 11, Adipogenesis inhibitory factor (AGIF), IL11 Accession P20809 1 Amino Acid Sequence Protein sequence (P20809 1, Pro22 Leu199, with N His tag) PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL Expression System HEK293 Molecular Weight Predicted MW: 20. 8 kDa Observed

Product Specification


Species Human
Synonyms Interleukin-11, Adipogenesis inhibitory factor (AGIF), IL11
Accession P20809-1
Amino Acid Sequence

Protein sequence (P20809-1, Pro22-Leu199, with N-His tag) PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Expression System HEK293
Molecular Weight Predicted MW: 20.8 kDa Observed MW: 20-26 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with N-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

IL-11 (Interleukin 11) is a pleiotropic cytokine in the IL-6 family. IL-11 is secreted by osteoblasts, synoviocytes, fibroblasts, chondrocytes, intestinal myofibroblasts, and trophoblasts, among other cell types. It is found in the plasma mainly during inflammation, such as that associated with viral infection, cancer, or inflammatory arthritis, and is considered to be primarily anti‑inflammatory. It stimulates hematopoiesis and thrombopoiesis, regulates macrophage differentiation, and confers mucosal protection in the intestine. It has also been found to enhance T cell polarization toward Th2, promote B cell IgG production, increase osteoclast bone absorption, protect endothelial cells from oxidative stress, and regulate epithelial proliferation and apoptosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 23566562288

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Carl L. Bradley
New York, US
★★★★★ 1
Kinda flimsy…
Thought the assembly was metal, it’s some kind of PVC.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 22, 2025
K
Verified Purchase
Kindle Customerttt
Waukegan, US
★★★★★ 5
Better than expected, these are great looking and heavy duty
Size: 42inch Tall (NOT included wood planks), Color: Black
These are heavy duty, and just as pictured. They are beautiful.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
K
Verified Purchase
Kimberly Frost
West Palm Beach, US
★★★★★ 5
Great value extra storage
Size: 42inch Tall (NOT included wood planks), Color: Black, Size: 42inch Tall (NOT included wood planks), Color: Black
This was a Great storage option for a corner where we had no cabinets, it has very stylish hardware Storage Space it’s quality built it fits well it’s very easy to install. It came with screws. All the hardware, I’m going to put white dishes on the shelves with my coffee bar.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 8, 2025
A
Verified Purchase
Anonymous
Charlottesville, US
★★★★★ 5
Quality pipes for a good price
Size: 42inch Tall (NOT included wood planks), Color: Black
This item is just as described. It is the pipe fitting portion of a 3 shelf unit. You must buy your shelving separately once the rails have been installed. Purchasing the pieces this way was much more cost-effective than separately buying each part from the hardware store, and all the pieces were clean and ready to be mounted unlike the pieces from the hardware store. It was moderately difficult to hang, since you are trying to keep everything very level. I imagine the distance between each rail will be a factor in how easy this is to level. The difficulty may have also stemmed from the fact that we were mounting it in a small toilet room and had little room to maneuver during the installation process. Still, it is a good product and we are considering purchasing a second one for another location in our home.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2019
B
Verified Purchase
B. Billy
New York, US
★★★★★ 4
Not real Black Iron, but works just as well
Size: 42inch Tall (NOT included wood planks), Color: Black
First, these parts that I got were not real Black Iron pipes like you would pick up at a hardware store, they are like furniture grade tubes for an IKEA shelving system. The thread would fit 3/4 pipe from like HD, but they are not the same, I know this because I just bought some of the pipe and parts for a small shelf right before ordering this. I should have known from the price, the real stuff is kind of pricey, but nicer. The elbows and T-connectors as well as the flanges seem more like galvanized steel painted black. HOWEVER, the end product is pretty nice and very versatile as to where you would want to put it. It is still pretty sturdy, and if screwed into a stud, I believe it would hold a lot of weight. The entire shelving system is painted black, so unlike Black Iron, it will not stain your hands black when handling it. Putting this together took about 30 min, the longest part was adjusting angles and lengths to get it flat and squared, but was not hard at all. This kit does NOT come with shelf boards, so length of that is up to you. It also came with mounting screws, but they are thin and I would suggest as your getting boards for shelves, also pick up some beefier screws, U used #12 - 1 1/4" wood screws with the sleeves for drywall and a little longer for securing it into a stud. All in all, this black pipe shelf looks nice, is nice and will work out great, just know, it is not the real Black Iron pipes and parts you would get from a hardware store, but the threads would fit if you wanted to add to this. I only knocked down one star because of this, and if I am going to buy more of these, I would prefer the real stuff and not go with this one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 5, 2020

recommand products