SKU: 23566562288

Human IL-11 Protein, His tag

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-11 Protein, His tagProduct Specification Species Human Synonyms Interleukin 11, Adipogenesis inhibitory factor (AGIF), IL11 Accession P20809 1 Amino Acid Sequence Protein sequence (P20809 1, Pro22 Leu199, with N His tag) PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL Expression System HEK293 Molecular Weight Predicted MW: 20. 8 kDa Observed

Product Specification


Species Human
Synonyms Interleukin-11, Adipogenesis inhibitory factor (AGIF), IL11
Accession P20809-1
Amino Acid Sequence

Protein sequence (P20809-1, Pro22-Leu199, with N-His tag) PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Expression System HEK293
Molecular Weight Predicted MW: 20.8 kDa Observed MW: 20-26 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with N-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

IL-11 (Interleukin 11) is a pleiotropic cytokine in the IL-6 family. IL-11 is secreted by osteoblasts, synoviocytes, fibroblasts, chondrocytes, intestinal myofibroblasts, and trophoblasts, among other cell types. It is found in the plasma mainly during inflammation, such as that associated with viral infection, cancer, or inflammatory arthritis, and is considered to be primarily anti‑inflammatory. It stimulates hematopoiesis and thrombopoiesis, regulates macrophage differentiation, and confers mucosal protection in the intestine. It has also been found to enhance T cell polarization toward Th2, promote B cell IgG production, increase osteoclast bone absorption, protect endothelial cells from oxidative stress, and regulate epithelial proliferation and apoptosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 23566562288

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 11 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
H
Verified Purchase
HONEST REVIEWER
Charlottesville, US
★★★★★ 4
Title: Solid, Reliable Ink – No Frills, No Surprises (4 ★)
Style: Ink
The Bottom Line The Epson 822 DURABrite Ultra Ink Standard‑Capacity Black & Color Cartridge Combo Pack (T822120‑BCS) does exactly what it promises: it prints clean, sharp pages on the WorkForce Pro WF‑3820/3823/4820/4830/4833/4834 series with no hiccups. It isn’t a game‑changing breakthrough, but it’s dependable enough that you can toss it in your cart, try it out, and feel confident you won’t be left with a printer jam or faded text. Why I Gave It Four Stars Aspect Verdict Comments Performance ★★★★★ Prints consistently on both black and color pages. Colors are vivid, blacks are deep, and there are no streaks or banding. Compatibility ★★★★★ Works flawlessly with all the WorkForce Pro models listed on the box. No driver updates or firmware tricks needed.Value ★★★★☆ Standard‑capacity cartridges are a bit pricier than high‑yield options, but you get the expected page yields (≈ 2,000 B / 1,800 C / M / Y). Packaging & Arrival ★★★★★ Packaged securely, the “OME” seal was intact, and the cartridges arrived ready to install. Innovation ★★☆☆☆ Nothing revolutionary – just solid, reliable ink. If you’re looking for a “wow” factor, this isn’t it. Return Policy ★★★★★ Amazon’s 30‑day liberal return policy makes the purchase low‑risk; you can always send it back if it doesn’t meet your expectations. Overall, the combo earns a four‑star rating because it meets every functional requirement without any drama, but it also doesn’t exceed expectations enough to merit a perfect score. What I Actually Did Unboxed the combo and confirmed the “OME” seal was intact – a quick visual check that the cartridges weren’t tampered with. Installed the black cartridge first, then the four color cartridges, following the printer’s on‑screen prompts. Ran a printer self‑test and printed a few typical office documents (reports, spreadsheets, a color flyer). Checked the print quality side‑by‑side with my old OEM cartridges. The results were virtually identical – no ghosting, no color shifts. Pros Plug‑and‑play: No quirks, no firmware hacks. Consistent quality: Straight‑forward, vibrant colors and clean blacks. Reliable supply: Works across the entire WorkForce Pro lineup mentioned. Risk‑free purchase: Amazon’s 30‑day return window lets you test without commitment. Cons Standard capacity only: If you print heavily, the higher‑yield (XL) versions would be more economical. No “wow” factor: It’s a solid, work‑horse cartridge, not a revolutionary ink formula. Price: Slightly higher than some off‑brand alternatives, though you pay for brand reliability. Who Should Consider This Home‑office users who need dependable daily printing without fuss. Small businesses that run a mix of black‑and‑white documents and occasional color marketing pieces. Anyone who values a hassle‑free experience and appreciates a generous return policy as a safety net. If you’re hunting for an ink set that will wow you with cutting‑edge technology, look elsewhere. If you just want a cartridge that does its job, lasts as expected, and won’t surprise you with printer errors, the Epson 822 DURABrite Ultra combo is a safe bet. Bottom line: It’s a reliable, as‑described product that earns my respect, just not my awe. Four stars—good enough to recommend, but not enough to call it a breakthrough.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 4, 2026
B
Verified Purchase
ben amarante
Draper, US
★★★★★ 5
Very good product and thanks for quality service.
Style: Ink
Arrived on time, good product and quality service. Thanks, and will buy again in the future.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
A
Verified Purchase
Amazon Customer
Lake Worth, US
★★★★★ 5
Fast Delivery
Style: Ink
Fast delivery. Easy to install.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 12, 2026
H
Verified Purchase
Hoffie51
Chelsea, US
★★★★★ 5
Our Standard Cartridges.
Style: Ink
These cartridges are the only ones that work for our Epson printer. in the past, I have tried 3rd party units with various degrees of success. Sometimes they will work and sometimes not. They are less expensive up front but, in the long run, I am going to stick with the genuine Epson product. They are the same price everywhere that I have shopped, so we purchase them from Amazon because of the free shipping. The Epson cartridges just work in our printer.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 4, 2026
K
Verified Purchase
Kee
Lowell, US
★★★★★ 5
Bright, Dependable, and Jam-Free — Excellent Printer Paper!
Size: 1 Ream | 500 Sheets, Style: Letter (8.5x11)
The Amazon Basics Multipurpose Copy Printer Paper is a dependable and high-quality choice for all the daily printing needs, offering a bright white finish that makes text and images look sharp and professional. It feeds smoothly through the printer without any jams or misfeeds, which is essential for maintaining productivity throughout the day. The 20 lb weight feels sturdy and durable, making it perfect for everything from internal memos to important client documents. A great value-for-money purchase that provides consistent results every single time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026

recommand products