SKU: 36232221605

CEACAM-6/CD66c His Tag Protein, Human

Sale price$234.00 Regular price$260.00
Save 10%

Pay in installments of $65.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CEACAM-6/CD66c His Tag Protein, HumanProduct Specification Species Human Synonyms CEACAM6, CD66c, CEAL, NCA Accession P40199 1 Amino Acid Sequence Lys35 Gly320, with C terminal 8*His KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGGGGSHHHHHHHH Expression

Product Specification


Species Human
Synonyms CEACAM6, CD66c, CEAL, NCA
Accession P40199-1
Amino Acid Sequence

Lys35-Gly320, with C-terminal 8*His KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

45-70kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1、Duxbury M S. et al. (2004) Overexpression of CEACAM6 promotes insulin-like growth factor I-induced pancreatic adenocarcinoma cellular invasiveness. Oncogene. 23(34): 5834-5842.

2、Lewis-Wambi J S. et al. (2008) Overexpression of CEACAM6 promotes migration and invasion of oestrogen-deprived breast cancer cells. Eur J Cancer. 44(12): 1770-1779.

Background

Carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen) (CEACAM6) is also known as CD66c (Cluster of Differentiation 66c), CEAL, NCA, and is one of seven human CEACAM family members within the immunoglobulin superfamily. Human CEACAM-6 is a 90 kDa, GPI-linked membrane protein that contains a 34 amino acid (aa) signal sequence, a 286 aa extracellular domain (ECD), and a 24 aa hydrophobic C-terminal propeptide. CEACAM-6 contains one N-terminal V-type Ig-like domain (N domain), followed by two C2-type Ig-like domains. It shows considerable glycosylation, including (sialyl) LewisX, which mediates binding to E-selectin, galectins and some bacterial fimbrae. CEACAM family members are widely expressed in epithelial, endothelial, and hematopoietic cells, including neutrophils, T-cells, and NK cells. CEACAMs appear to be capable of transmitting signals that result in a variety of effects depending on the tissue, including tumor suppression, tumor promotion, angiogenesis, neutrophil activation, lymphocyte activation, regulation of the cell cycle, and regulation of adhesion. CEACAMs have now been associated with numerous intracellular signaling processes including cell adhesion, cell growth, recognition and differentiation, angiogenesis, and apoptosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 36232221605

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
DD
Carnegie, US
★★★★★ 4
Boys’ 5‑Piece Linen Suit Set
Color: Beige, Size: 16, Color: Beige, Size: 16
I ordered this 5‑piece linen suit in size 16 in the beige color. The set includes the jacket, pants, dress shirt, bow tie, and a slip‑on tie. The outer fabric is a blend of 70% polyester, 25% linen, and 5% spandex, and the lining is 100% polyester. The material is lightweight, which works well for warm‑weather events, but the pants are noticeably thinner than the jacket. The jacket feels sturdier because of the full lining. The jacket has a peak lapel, flap pockets, and cuff buttons, and the stitching and seams are tight and even. I did notice a few loose threads, but the fabric itself was smooth with no tears or flaws. The pants have an adjustable waistband, which is helpful, but the length was too long and will need to be tailored. The overall cut of the suit seems designed for children on the thinner side. The shirt included in my set was a pleated style rather than a plain dress shirt. It wasn’t the style shown in the product photos, and I would have preferred a standard shirt that could be worn for various occasions rather than a very formal shirt. The tie is a pre‑tied slip‑on style with an elastic band. I would have preferred a traditional tie instead. The suit arrived in good condition with no damage, and the color was even throughout all pieces. The price is on the higher end for similar 5‑piece sets. I rated it 4 stars because the jacket is well made and the set includes all the expected pieces, but the thin pants, unexpected pleated shirt, and slip‑on tie kept it from being perfect.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 16, 2026
J
Jacobson
Louisville, US
★★★★★ 5
Adorable and Well‑Made Outfit for Special Events
Color: Light Blue, Size: 10, Color: Light Blue, Size: 10
Got this suit set for my son and absolutely love it. It comes with everything he needs to look sharp, and I really appreciate that it includes both a tie and a bow tie so we can switch up the style depending on the occasion. The quality is impressive for the price — the fabric feels light and comfortable, and the whole outfit has a polished look without being stiff or uncomfortable. The fit was spot on, and the adjustable waistband is a huge help for getting it just right. My son looked great in it, and it’s definitely something he can wear for more than one event. The little details on the jacket and pants give it a classic, dressed‑up feel that works for weddings, holidays, or any special moment. Overall, it’s a stylish, practical set that makes getting him ready so much easier. Really happy with this purchase.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2026
C
Crystal
Alexandria, US
★★★★★ 4
Boys linen fabric suit
Color: Light Green, Size: 16
Boys suit set in a lighter green color. This suit is made with good proportions and seems to fit well. The sizing seems slightly big so maybe size down one size. The fabric does wrinkle easily so be aware that sitting and folding the suit may cause wrinkling. Otherwise it is a very nice suit for a formal occasion. It comes in many good colors.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
A
Atherney Family Farm
Grantham, US
★★★★★ 5
Nice elegant suit for any occasion.
Color: Light Blue, Size: 12, Color: Light Blue, Size: 12
The suit set is very nice, the fabric material is durable and soft. Overall stitching is tight with nice surging of the hems and great construction on the shoulders. Buttons and button wholes are well done. I'm going to iron in the creases on the front of the pants because they weren't folded properly for shipping. The material does hold on to wrinkles so don't be afraid of your iron to get a super sharp look. The color is a soft baby blue that stands out in a crowd of black suits. With the option of an elastic tie or clip on bowtie this is everything you need to make him look presentable for a variety of occasions. My only complaint about this suit kit is the dress shirt is stiff and thin. I found some loose threads that I don't trust to not get played with. I'll probably trade it out for something with a little more cotton. As far as cost goes mid range, but definitely worth the cost. I might consider something with a vest if it's a super formal event, but I'm very happy with how this suit comes together.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026
M
Martin V.
Natrona Heights, US
★★★★★ 5
Modern luxury with summer fabric that performs above its price!
Color: Beige, Size: 14, Color: Beige, Size: 14
Wow! My son wore it for Easter Sunday and this suit fits the bill! The linen material is spot on--not too heavy and not too light especially since the weather is warming up now. The jacket is quality made--the design is modern executive, the stitches are strong no flaws to note. The pants are tad bit longer but that's okay, build quality is also great. The white shirt is decent and matches well with the rest of the set. The bow tie and tie itself is a great complimentary to the set, though optional to wear. The whole set just has that quality you would really look for in the price range you would want to pay. Overall, best value for for the, wear right outside the bag, maybe a light ironing otherwise it's perfect! I highly recommend it, no complaints here very happy with this suit!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 5, 2026

recommand products