SKU: 45246562839

MUC-1(116-173) Fc Chimera Protein, Human

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

MUC-1(116-173) Fc Chimera Protein, HumanProduct Specification Species Human Synonyms Mucin1, MUC1, CD227, EMA, H23AG, KL6, MAM6, MUC1, ZD, PEM, PEMT, PUM, CA15 3 Accession P15941 Amino Acid Sequence Ser116 Gly173, with C terminal Human IgG1 Fc

Product Specification


Species Human
Synonyms Mucin1, MUC1, CD227, EMA, H23AG, KL6, MAM6, MUC1, ZD, PEM, PEMT, PUM, CA15-3
Accession P15941
Amino Acid Sequence Ser116-Gly173, with C-terminal Human IgG1 Fc SVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Expression System HEK293
Molecular Weight 36-42kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Brayman M. et al. (2004) MUC1: a multifunctional cell surface component of reproductive tissue epithelia. Reprod Biol Endocrinol 2: 4.

2、Schroeder J A. et al. (2001) Transgenic MUC1 interacts with epidermal growth factor receptor and correlates with mitogen-activated protein kinase activation in the mouse mammary gland. J Biol Chem. 276(16): 13057-64.

3、Li Y. et al. (2001) The epidermal growth factor receptor regulates interaction of the human DF3/MUC1 carcinoma antigen with c-Src and beta-catenin. J Biol Chem. 276(38): 35239-42.

Background

Mucin 1, cell surface-associated (MUC1) or polymorphic epithelial mucin (PEM) is a membrane-bound protein that is a member of the mucin family. Mucins are heavily glycosylated proteins that give the mucosa viscous gel-forming properties, and contribute to the structural organization of secretory epithelia. The mucosa serves as a physical barrier to protect the epithelium from harsh environments such as low pH and microbial infections. Cell surface associated mucins, such as Mucin-1 (Muc-1), are important components of the mucosal barrier that exist at the interface of the apical surface between secreted mucins and the cell surface. In addition to the mucus-type functions of its extracellular mucin domain, Muc-1 is a transmembrane protein with a cytoplasmic tail that is a known target of multiple kinases that has been shown to participate in normal and oncogenic signaling.Muc-1 is overexpressed and aberrantly glycosylated in many cancers, where it has been documented to play an important role in inflammation and tumor progression.Muc-1 is also expressed on many non-epithelial cell types including leukocytes, where its function is less well characterized. It has been documented that Muc-1 controls inflammation resulting from Helicobacter pylori infection by suppressing activation of the NLRP3 inflammasome. Knockout of Muc-1 also results in aberrant expansion of myeloid derived suppressor cells from the bone marrow.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 45246562839

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Alexandria, US
★★★★★ 5
Good value.
Style: 20 Ounces, Size: 150 Count (6 Packs of 25 Bowls)
Good value. Good Product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
J
Verified Purchase
Jean Paul
Pawtucket, US
★★★★★ 5
Strong, Reliable Plates for Everyday Use
Style: 10 Inch, Size: 100 Count
These Dixie Ultra paper plates are a great upgrade from regular disposable plates. They’re strong and sturdy, so they don’t bend or leak even with heavier or saucy foods. Perfect for everyday meals, cookouts, or quick cleanups when you don’t feel like doing dishes. The 10-inch size is just right for full meals, and the pack lasts a good while. I’ve used them for hot foods without any issues—they hold up really well. Overall, dependable quality and worth paying a little extra compared to cheaper, flimsy options.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2026
M
Verified Purchase
1Meza
Carnegie, US
★★★★★ 5
Best Plates Ive ever known!
Style: 10 Inch, Size: 172 Count (Pack of 1), Style: 10 Inch, Size: 172 Count (Pack of 1)
If you’re tired of the "double-plate shimmy" where you have to stack two flimsy plates just to survive a barbecue, the Dixie Ultra 10-Inch Plates are a total game-changer. This 172-count bulk pack is the gold standard for anyone who actually likes to pile on the food. Why They’re Worth It: True Strength: The "3X Stronger" claim isn't just marketing fluff. These can handle a massive helping of steak, potato salad, and corn on the cob without folding under pressure. Soak-Proof Shield: They feature a high-quality coating that keeps grease and sauces from leaking through to your lap or your table. Microwave Safe: Unlike some cheaper alternatives, these don't get soggy or "wilt" when you're reheating leftovers. Value Size: Getting 172 plates (divided into 4 convenient packs) means you're set for multiple parties, holidays, or just those nights when you really don't want to do the dishes. Bottom Line: These are the "heavy lifters" of the paper plate world. They’re large enough for a full dinner and tough enough to handle the messiest meals. Highly recommended for anyone who values durability over price-point flimsy alternatives.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 16, 2026
L
Verified Purchase
lynn
Alexandria, US
★★★★★ 5
Quality disposable plates
Style: 10 Inch, Size: 172 Count (Pack of 1)
We purchase these again and again for their durability and thickness for our everyday use of disposable dinnerware. True to size and reliable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026
H
Verified Purchase
HB
Louisville, US
★★★★★ 5
Excellent
Style: 10 Inch, Size: 44 Count
These plates are my go to. Love the colors and the design. They are a perfect size and extremely durable. I use these almost everyday. Another great quality product
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026

recommand products