SKU: 48927096138

Biotinylated Nectin-2/CD112 His&Avi Tag Protein, Human

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated Nectin-2/CD112 His&Avi Tag Protein, HumanProduct Specification Species Human Synonyms CD112, Nectin 2, PVRL2 Accession Q92692 2 Amino Acid Sequence Gln32 Leu360, with C terminal 8*His&Avi tag

Product Specification


Species Human
Synonyms CD112, Nectin-2, PVRL2
Accession Q92692-2
Amino Acid Sequence

Gln32-Leu360, with C-terminal 8*His&Avi tag QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGGGGGSGGGSHHHHHHHHGLNDIFEAQKIEWHE

Expression System HEK293
Molecular Weight

45-54kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Biotin
Tag Avi Tag, His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Minai-Fleminger Y. et al. (2009) Mast cells and eosinophils: the two key effector cells in allergic inflammation. Inflammation Research. 58(10): 631-638.

Background

Nectin-2, also known as CD112, is a cell adhesion molecule that belongs to the Nectin family. Nectin is highly homologous to human poliovirus receptors and also known as a poliovirus receptor-associated protein. The Nectin family consists of four members: Nectin-1, Nectin-2, Nectin-3, and Nectin-4. Nectin protein had three consecutive immunoglobulin-like domains outside the cell, namely, the Ig-V domain at the N terminal and two Ig-C2 domains at the C terminal. Nectin-2 is found in neurons, endothelial cells, epithelial cells, and fibroblasts. Nectin-2 can bind pseudorabies virus and herpes simplex virus-2 (HSV-2) and participate in the intercellular transmission of these viruses, but cannot bind HSV-1 and has a low binding affinity with TIGIT. Nectin-2 was identified as a ligand for DNAM-1 (CD226), whose CD226/CD112 interaction mediates cytotoxicity and cytokine secretion in T and NK cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 48927096138

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 11 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
SC Power Engineering Co.
Houston, US
★★★★★ 5
Excellent build quality and thick chrome, strong threaded screw
Color: Silver
I purchased this as a gift for a friend that had problems with wine corks being broken and left inside the bottle. The intention was to have this longer tapered screw extend all the way beyond the bottom of the cork to pull out the entire cork without leaving pieces inside the bottle. One detail that is missing from the instructions is the secret to how a wine cork remover must be used to insure success. The tapered screw must be twisted many turns, which will raise the two lever arms directly upwards away from the bottle. It is critical that you keep turning the screw and remove the metal or paper seal that is on the outside of the bottle before you stop turning. By looking at the bottom of the cork inside the bottle, you can watch the end of the tapered screw appear as it is turned deep inside the cork, beyond the bottom of the cork. Once you have visual verification that the screw is all the way in, notice the appearance of the TOP of the screw outside the cork. You will see that it appears to have been turned very far, potentially damaged the outer surface of the cork. That is a GOOD sign that you used enough rotations of the screw to correctly engage the entire cork. Never skip these steps before you proceed to remove the cork. When the screw is in the correct position, the two levers are all the way up. It may take some force to push them down, so put the wine bottle in a SINK, not a countertop. This lowers the bottle for easier access and gives you a safe place to put the cork remover after you open the bottle. Using a controlled force with both hands, move both levers down carefully to make sure that you do not deflect the tapered screw in a way that is misaligned with the neck of the bottle. As the cork is removed, the last part may be fragile from contact with the wine. In addition, the entire cork remover becomes less stable, and free to pivot if you are not careful. This last motion can still damage a cork and create fragments, so just be careful and precise to gently pivot the levers all the way down and then if necessary use a twisting motion to ease the last part of the cork out of the bottle. This method has never failed to remove hundreds of corks from bottles made all over the world without wrecking the cork. Try it and you will never have a broken cork problem again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 7, 2022
A
Verified Purchase
Amazon Customer
Draper, US
★★★★★ 4
Good Quality
Color: Silver
Easy to use. Seems to be better quality than others I have had.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 13, 2026
A
Verified Purchase
Amazon Customer
Carnegie, US
★★★★★ 5
Sturdy
Color: Silver
Sturdy and effective!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2026
C
Verified Purchase
Carolyn P.
West Palm Beach, US
★★★★★ 5
Exceptional design
Color: Silver
Best corkscrew I have ever purchased. Loved the design which is very easy to use. The design is very attractive and adds to my decor. I give it 10 stars!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
A
Verified Purchase
AJEvyDar
Draper, US
★★★★★ 5
Sturdy and easy to use
Color: Silver
Ordered this one to replace another type that snapped apart in my hand. The Beneno Wine Opener is sturdy and easy to use. The inner silicone collar helps guide the mechanism around the bottle and cork. Opening is clean and almost effortless.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 8, 2026

recommand products