Pay in installments of $40.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 21 - Jul 26
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Apolipoprotein A-I/APOA1 His Tag Protein, HumanProduct Specification Species Human Synonyms Apolipoprotein A I, Apo AI, ApoA I, Apolipoprotein A1, APOA1; Apolipoprotein A I, Apo AI, ApoA I, Apolipoprotein A1, APOA1 Accession P02647 Amino Acid Sequence Asp25 Gln267, with N 6*His
Product Specification
| Species | Human |
| Synonyms | Apolipoprotein A-I, Apo-AI, ApoA-I, Apolipoprotein A1, APOA1;Apolipoprotein A-I, Apo-AI, ApoA-I, Apolipoprotein A1, APOA1 |
| Accession | P02647 |
| Amino Acid Sequence | Asp25-Gln267, with N-6*His MHHHHHHDDDDKDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ. |
| Expression System | E.coli |
| Molecular Weight | 29.6 kDa |
| Purity | ＞98% by SDS-PAGE and RP-HPLC |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 20mM Tris-HCl, 100mM NaCl, pH8.0 |
| Reconstitution | Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation . |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
Apolipoprotein A-I/APOA1 mainly exists in high density lipoprotein (HDL) particles, which can prevent excessive accumulation of cholesterol in macrophages, form foam cells, deposit on the arterial wall, and cause atherosclerosis. The main function of APOA1 is to activate lecithin cholesterol acyltransferase (LCAT) in HDL complex, catalyze cholesterol esterification, and then dissolve more cholesterol-HDL complex, increase the cholesterol transport capacity of HDL particles and the ability of liver to metabolize cholesterol. Therefore, APOA1 is an important marker to evaluate the ability of blood cholesterol clearance.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.6 ★★★★★
Based on 26 reviews
Sort
Product Reviews
★★★★★ 5
Great for the price
The item is great bit I wish it were a bit more sturdy and it folded flat. It folds into a square so it does take up some room when it's not in use.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2021
★★★★★ 1
Cheap, screw holes don't line up, screen is to short, and bars take WD-40 and a mallet
This has been my worst purchase on Amazon ever. DO NOT BUY. My first issue was that bars #4 and #5 would not go together, I ended up buying WD-40 and a mallet and that kind of got them together. Now I went to but the screen on (which is almost see thought) and the screen is to short. I can't attached the bottom bar to the tall bar. The screw hole is in the wrong spot, so the screen is not secure. No amount of pulling on the screen will make it grown .25" longer. Since I can't get the bars secure the walls are not steady and fall over easily. The feet did go together very nice. I can't return them according to Amazons policy. I bought 2 sets. I'm not going to try to build the other set I have. And I can't take apart the first set, since the bars are so tightly together. Also the polls have rust on them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 10, 2023
★★★★★ 3
Very Poor Built Quality
Color: Black, Size: 3-Panel
They use cheap tarp like cloth that you might find on a tent, so it is not suitable as a teleconferencing background without blur applied. The legs are flimsy and lack rubber feet, so it will scratch floors. The tubing is flimsy and very hard to move and adjust. This is only good if you are setting it up somewhere like a gym or a garage.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 12, 2025
★★★★★ 5
Great separator for room.
My kids love it. It separates their half of the room.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 25, 2025
★★★★★ 5
These are PERFECT for my Art Show coming up!
This is going to be PERFECT for my Art Show display. And also....EASY to put up and take down as well as store. I'm so grateful to have found them! They are super light weight. And sturdy for my application. And elegant and have clean lines for my display. I have ivy draped and also fairy lights which make it look classy yet simple!
Love them!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 27, 2022
recommand products
Dining table, 230x100cm
879.90
KK Kids Sofa, Soft rose w rose buttons
312.00
Personalized 3-piece Duvet Cover Bedding Set Buck Hunting Bedding Set TDCTG
77.99
Personalized 3-piece Duvet Cover Bedding Set Sunflower Family To My Dear Mom From Daughter Bedding Set IYQQ
77.99
Luxury King Size Bedding Set, Violet Cozy Bedding Set, Lavish Soft Duvet Cover Set, Royal Purple Bandana Bedding Sets, Gifts for Purple
77.99