SKU: 71267205476

FITC-Labeled CEACAM-5/CD66e His Tag Protein, Human

Sale price$220.50 Regular price$245.00
Save 10%

Pay in installments of $61.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FITC-Labeled CEACAM-5/CD66e His Tag Protein, HumanProduct Specification Species Human Antigen CEACAM 5 CD66e Synonyms CEA; CD66e Accession P06731 Amino Acid Sequence Lys35 Ala685, with C terminal 10*His

Product Specification


Species Human
Antigen CEACAM-5/CD66e
Synonyms CEA; CD66e
Accession P06731
Amino Acid Sequence

Lys35-Ala685, with C-terminal 10*His

KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGGGSGGGSHHHHHHHHHH


Expression System HEK293
Molecular Weight 95-120kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation FITC
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.The carcinoembryonic antigen (CEA) family: structures,suggested functions and expression in normal and malignant tissues. (1999). SeminCancer Biol. 9(2):67-81.

Background

The human CEA family has been fully characterized. It comprises 29 genes of which 18 are expressed; 7 belonging to the CEA subgroup and 11 to the pregnancy specific glycoprotein subgroup. CEA is an important tumor marker for colorectal and some other carcinomas. The CEA subgroup members are cell membrane associated and show a complex expression pattern in normal and cancerous tissues with notably CEA showing a selective epithelial expression. Several CEA subgroup members possess cell adhesion properties and the primordial member, biliary glycoprotein, seems to function in signal transduction or regulation of signal transduction possibly in association with other CEA sub-family members.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 71267205476

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
emmasize
Louisville, US
★★★★★ 5
Incredible Dupe
Color: Pink, Size: Throw (50" X 60")
I never leave reviews, but I was looking for a dupe blanket for my kiddos after getting a much more expensive brand blanket for myself, and this one is excellent. It’s double-sided so the same mega-soft on each side and cozy but not too heavy. I’m now getting them as Christmas gifts for everybody. A+ purchase
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 15, 2025
A
Verified Purchase
Amazon Customer
Port Orchard, US
★★★★★ 5
Oh my!!!
Color: Pink, Size: Throw (50" X 60")
This is the softest blanket ever! I sleep with it next to my skin and my bigger blanket on top because I so love how soft it is. If they ever make this in a larger size I will definitely get it!!!! LOVE THIS!!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 18, 2025
L
Verified Purchase
Lisa L
Phoenix, US
★★★★★ 5
Warm, cozy and thick high-quality throw.
Color: Cream, Size: Throw (50" X 60")
This is thick, non-shedding blanket - and for cold, winter nights… THE BEST. My granddaughters found it to be too warm, but not this grandma! I’m fit, but dang, these super-cold Alaska nights allow me to stay warm and cozy! If you have someone who runs a bit on the colder side, they will love this blanket! It washes beautifully. Great value!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 24, 2025
A
Verified Purchase
Amazon customer
Chelsea, US
★★★★★ 5
Worth every penny!!
Oh my god it’s SO LUXURIOUS! And WARM! And heavy in a good way! I feel like a queen, I feel so happy when I look at it when I run my hand across it, when I wrap up in it. It just is stunning and cozy and perfect. The twin size almost feels extra large because I sleep comfortably under it on my queen size bed, and so far- no shedding. I haven’t washed it yet but as you can see it didn’t need it to undo any vacuum sealing- super fluffy right out of the box and no chemical smell I just put it right on my bed! I got it on sale for $43 I believe, and personally I think that’s a steal. This feels like those $200 blankets everyone talks about.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 29, 2026
D
Verified Purchase
DMarshall
Waukegan, US
★★★★★ 5
Super luxe throw!
Color: Solid - Beige, Size: Throw (50" x 60"), Color: Solid - Beige, Size: Throw (50" x 60")
This is an absolutely incredible throw/blanket, especially for the price. Beautiful neutral color that will go with any decor. Very siIky to the touch with a coolness to it (hard to describe), thick and dense, and has a wonderful weight to it. It will be so cozy and warm in the cooler months. I own four Lola blankets at over $299 each (gulp) and these absolutely rival that brand in both quality and overall value. The faux fur/mink feels exactly the same for both brands. The only visible difference is that the back side of the WDCOZY brand is lined in a different material which also has a great quality feel and texture to it, very luxe. I've already ordered several more for Christmas gifts and for our AirBNB. I photographed the WDCOZY on the left comparing it to the Lola on the right. You can see how much fluffier the WDCOZY brand is. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 16, 2025

recommand products