Pay in installments of $90.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 22 - Jul 27
For Your Every Summer RSVP, with Code: SUMMER15
Description
PCSK9 His Tag Protein, RatProduct Specification Species Rat Synonyms PCSK9, FH3, PC9, FHCL3 Accession P59996 Amino Acid Sequence Gln31 Gln691, with C terminal 10*His
Product Specification
| Species | Rat |
| Synonyms | PCSK9, FH3, PC9, FHCL3 |
| Accession | P59996 |
| Amino Acid Sequence | Gln31-Gln691, with C-terminal 10*His QDEDGDYEELMLALPSQEDSLVDEASHVATATFRRCSKEAWRLPGTYVVVLMEETQRLQVEQTAHRLQTWAARRGYVIKVLHVFYDLFPGFLVKMSSDLLGLALKLPHVEYIEEDSLVFAQSIPWNLERIIPAWQQTEEDSSPDGSSQVEVYLLDTSIQSGHREIEGRVTITDFNSVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGTSLHSLRVLNCQGKGTVSGTLIGLEFIRKSQLIQPSGPLVVLLPLAGGYSRILNTACQRLARTGVVLVAAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGKDIIGASSDCSTCYMSQSGTSQAAAHVAGIVAMMLNRDPALTLAELRQRLILFSTKDVINMAWFPEDQRVLTPNRVATLPPSTQETGGQLLCRTVWSAHSGPTRTATATARCAPEEELLSCSSFSRSGRRRGDRIEAIGGQQVCKALNAFGGEGVYAVARCCLLPRVNCSIHNTPAARAGPQTPVHCHQKDHVLTGCSFHWEVENLRAQQQPLLRSRHQPGQCVGHQEASVHASCCHAPGLECKIKEHGIAGPAEQVTVACEAGWTLTGCNVLPGASLPLGAYSVDNVCVARIRDAGRADRTSEEATVAAAICCRSRPSAKASWVHQGGGSGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 60-70kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1、Jaén R I. et al. (2022) Functional Crosstalk between PCSK9 Internalization and Pro-Inflammatory Activation in Human Macrophages: Role of Reactive Oxygen Species Release. Int J Mol Sci. 23(16): 9114. |
Background
PCSK9 (proprotein convertase subtilisin-kexin type 9) is a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. PCSK9 undergoes an autocatalytic processing event with its prosegment in the ER and is constitutively secreted as an inactive protease into the extracellular matrix and trans-Golgi network. It is expressed in liver, intestine and kidney tissues and escorts specific receptors for lysosomal degradation. It plays a role in cholesterol and fatty acid metabolism. Atherosclerosis is a cardiovascular disease caused mainly by dyslipidemia and is characterized by the formation of an atheroma plaque and chronic inflammation. Proprotein convertase subtilisin/kexin type 9 (PCSK9) is a protease that induces the degradation of the LDL receptor (LDLR), which contributes to increased levels of LDL cholesterol and the progress of atherosclerosis.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.2 ★★★★★
Based on 6 reviews
Sort
Product Reviews
★★★★★ 5
Very nice pillowcases
Color: 06 - Beige, Size: Standard (20" X 26")
These pillowcases are really nice. They're soft and wash well. I really like the pocket on the end. It makes your pillows look nice and neat. The price is good too.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
★★★★★ 3
Love the sheets but GOSH THEY STINK
Color: 19 - Forest Green, Size: Queen (20" X 30")
I have the dark green sheets and bought these for extra cases to match. I would give them 5 stars if it weren’t for the fact that they smell absolutely horrible. I am so surprised after reading reviews that more people don’t mention it?! Maybe it’s more prominent in darker colors but I have washed these now 3 different times even with scent beads and still hate the smell. I wish I could accurately describe what it smells like— it’s just not good and for some reason, body heat only exacerbates it and makes the smell even worse and I wake up feeling like a smell like the sheets… which isn’t a good thing.
Besides that, I do really enjoy them. They feel great on your skin and I love the color. I wish the smell didn’t kill them so badly for me ☹️
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 9, 2026
★★★★★ 5
Comfy soft pillow covers
Color: 02 - White, Size: Queen (20" X 30"), Color: 02 - White, Size: Queen (20" X 30")
Absolutely love these pillow cases! I bought 2 sets. After I received them & washed & dried them they did remain wrinkly. I just went ahead and put them on my pillows & the wrinkles went away. I continue to love the feel, coolness & comfort. Will definitely buy more.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 5, 2026
★★★★★ 5
Great soft pillow cases
Color: 03 - Navy, Size: Standard (20" X 26")
Pillow cases are beautiful and soft, great quality. I had to return them because standard were too small. I am going to order queen instead.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 9, 2026
★★★★★ 5
These Bamboo Pillowcases Made Me Realize I Sleep Hot
Color: 07 - Cream, Size: Queen (20" X 30"), Color: 07 - Cream, Size: Queen (20" X 30")
I bought these mostly because I kept hearing people talk about bamboo pillowcases and honestly thought it sounded a little overhyped, but I totally get it now. The first thing I noticed was how cool they felt compared to regular cotton. I tend to get warm when I sleep and flip my pillow a million times during the night looking for the cold side, and these actually stay noticeably cooler longer.
They also feel really soft without having that weird slippery texture some silky pillowcases have. My skin has been less irritated lately and my hair definitely looks less frizzy in the mornings. I have thick hair that tangles easily overnight, and these have helped more than I expected.
Another thing I appreciate is that they’ve washed well so far. I was worried they’d pill or lose softness after a wash cycle, but they still feel smooth and nice. They also just make the bed feel cleaner and more comfortable overall. One of those small upgrades that ends up making a bigger difference than you’d think.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2026