Pay in installments of $65.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 22 - Jul 27
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Biotinylated CD155/PVR His&Avi Tag Protein, HumanProduct Specification Species Human Synonyms PVR, FLJ25946, PVS, CD155, TAGE4, HVED, NECL5 Accession P15151 Amino Acid Sequence Trp21 Asn343, with C terminal 8*His&Avi tag
Product Specification
| Species | Human |
| Synonyms | PVR, FLJ25946, PVS, CD155, TAGE4, HVED, NECL5 |
| Accession | P15151 |
| Amino Acid Sequence | Trp21-Asn343, with C-terminal 8*His&Avi tag WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRNIEGRMDHHHHHHHHGLNDIFEAQKIEWHE |
| Expression System | HEK293 |
| Molecular Weight | 65-75kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Biotin |
| Tag | Avi Tag, His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1、Kučan Brlić P. et al. (2019) Targeting PVR (CD155) and its receptors in anti-tumor therapy. Cell Mol Immunol. 16(1): 40-52. |
Background
CD155 is a member of the immunoglobulin superfamily also known as the human receptor for poliovirus (PVR). The full length (or PVR alpha isoform) is synthesized as a 417 amino acid (aa) precursor that contains a 20aa signal sequence, a 323aa extracellular region, a 24aa TM segment and a 50aa cytoplasmic tail. It has been demonstrated that CD155 can be recognized and bond by DNAM-1 and CD96 which promote the adhesion, migration and NK-cell killing, and thus efficiently prime cell-mediated tumor-specific immunity. CD155 is expressed at high levels in several human malignancies and seems to have pro tumorigenic and therapeutically attractive properties that are currently being investigated in the field of recombinant oncolytic virotherapy. More intriguingly, PVR participates in a considerable number of immunoregulatory functions through its interactions with activating and inhibitory immune cell receptors. These functions are often modified in the tumor microenvironment, contributing to tumor immunosuppression.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy